SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2k9q_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2k9q_A
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000157
Family POU-specific domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2k9q_A
Sequence length 77
Comment mol:protein length:77 uncharacterized protein
Sequence
melsnelkverirlsltaksvaeemgisrqqlcnieqsetapvvvkyiaflrskgvdlna
lfdriivnklehhhhhh
Download sequence
Identical sequences 2k9q_A 2k9q_B 000169511|e2k9qA1|101.1.4.66|A:1-77 000352447|e2k9qB1|101.1.4.66|B:1-77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]