SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2lcv_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2lcv_A
Domain Number 1 Region: 11-55
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.71e-21
Family SCOPe 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2lcv_A
Sequence length 67
Comment mol:protein length:67 HTH-type transcriptional repressor CytR
Sequence
mkakkqetaatmkdvalkakvstatvsralmnpdkvsqatrnrvekaarevgylpqpmgr
nvkrnes
Download sequence
Identical sequences cath|current|2l8nA00/9-55 2l8n_A 2lcv_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]