SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2mez_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2mez_A
Domain Number 1 Region: 9-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000181
Family EDF1-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2mez_A
Sequence length 106
Comment mol:protein length:106 Multiprotein Bridging Factor (MBP-like)
Sequence
enaeleivtdyykiiktareqlgisqqqlaqklkvsenivkrfesgklkptisqarqlek
ilgiklvtplenneesekefddtgltlgdvvnikegkklehhhhhh
Download sequence
Identical sequences 2mez_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]