SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2o20_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2o20_A
Domain Number 1 Region: 62-325
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.56e-90
Family L-arabinose binding protein-like 0.000000108
Further Details:      
 
Domain Number 2 Region: 7-51
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.74e-29
Family GalR/LacI-like bacterial regulator 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2o20_A
Sequence length 332
Comment mol:protein length:332 Catabolite control protein A
Sequence
MVESTTTIYDVARVAGVSMATVSRVVNGNANVKEKTRQKVLEAIAELDYRPNAVARGLAS
KRTTTVGVILPTITSTYFAAITRGVDDIASMYKYNMILANSDNDVEKEEKVLETFLSKQV
DGIVYMGSSLDEKIRTSLKNSRTPVVLVGTIDGDKEIPSVNIDYHLAAYQSTKKLIDSGN
KKIAYIMGSLKDVENTERMVGYQEALLEANIEFDENLVFEGNYSYEQGKALAERLLERGA
TSAVVSHDTVAVGLLSAMMDKGVKVPEDFEIISGANSPITQYTYPTLTSVNQPLYDLGAV
AMRLLTKLMLKEDVEQNQLVLDHEIFSRRSTK
Download sequence
Identical sequences A0A0B8QQS9 A0A199YQV9 A0A2A9IN00 D2BKT8 G6F972 H5T0L1 T0WKB3 U6EP21
WP_003129447.1.1423 WP_003129447.1.15333 WP_003129447.1.1581 WP_003129447.1.20412 WP_003129447.1.22261 WP_003129447.1.22922 WP_003129447.1.24694 WP_003129447.1.28005 WP_003129447.1.30056 WP_003129447.1.32081 WP_003129447.1.32884 WP_003129447.1.35037 WP_003129447.1.35288 WP_003129447.1.38445 WP_003129447.1.39480 WP_003129447.1.39902 WP_003129447.1.40656 WP_003129447.1.41962 WP_003129447.1.47514 WP_003129447.1.4910 WP_003129447.1.49120 WP_003129447.1.49631 WP_003129447.1.51877 WP_003129447.1.5208 WP_003129447.1.52733 WP_003129447.1.54010 WP_003129447.1.55618 WP_003129447.1.56612 WP_003129447.1.57644 WP_003129447.1.60011 WP_003129447.1.61814 WP_003129447.1.62525 WP_003129447.1.6264 WP_003129447.1.69015 WP_003129447.1.70979 WP_003129447.1.71573 WP_003129447.1.7442 WP_003129447.1.75712 WP_003129447.1.77362 WP_003129447.1.79735 WP_003129447.1.8561 WP_003129447.1.89978 WP_003129447.1.90754 WP_003129447.1.91600 WP_003129447.1.92226 WP_003129447.1.92751 WP_003129447.1.93624 WP_003129447.1.94616 WP_003129447.1.96756 WP_003129447.1.97467 WP_003129447.1.98285 WP_003129447.1.9968 gi|459285846|ref|YP_007508951.1| 2o20_A 2o20_B 2o20_C 2o20_D 2o20_E 2o20_F 2o20_G 2o20_H gi|385831106|ref|YP_005868919.1| gi|281492229|ref|YP_003354209.1| 684738.LLKF_1805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]