SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ox6_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ox6_B
Domain Number 1 Region: 5-166
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.71e-91
Family YdiL-like 0.0000000612
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2ox6_B
Sequence length 166
Comment mol:protein length:166 Hypothetical protein SO3848
Sequence
MSKNIGLNAIEMSYLRQSLSLSAAQVGQLTNHSEAEVLAWENAETQAPELAQKKLLDIDD
IIEMQVLNTTDGIEALFKKEPKRHLAFVVYPTQAIYTQYNPEFLSSLPLTELYNTAAWRI
KKECKLVLEVDVSLINLNVEAYKAYREQNGLSESRESRAKWAATQL
Download sequence
Identical sequences Q8EAP9
gi|24375337|ref|NP_719380.1| APC83631 2ox6_A 2ox6_B 2ox6_C 2ox6_D NP_719380.1.27637 2ox6A 211586.SO_3848 cath|current|2ox6A00/5-166 cath|current|2ox6B00/5-166 cath|current|2ox6C00/4-166 cath|current|2ox6D00/6-166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]