SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2p0s_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2p0s_B
Domain Number 1 Region: 8-140
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.13e-37
Family PG0945 N-terminal domain-like 0.000000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2p0s_B
Sequence length 143
Comment mol:protein length:143 ABC transporter, permease protein, putative
Sequence
snaqlggdmktiaiadrtgeyeqlfkendefrfvhaektaeeyrkmgadksgidavleir
qdlledpnavaiygykqlpasvsnhisrilsdylsdkkiasynipdikqiladskielsv
htykwsedgtnertsgelasgis
Download sequence
Identical sequences 2p0s_A 2p0s_B 2p0sA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]