SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2p5t_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2p5t_C
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.89e-16
Family SinR domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2p5t_C
Sequence length 158
Comment mol:protein length:158 Putative transcriptional regulator PezA
Sequence
MIGKNIKSLRKTHDLTQLEFARIVGISRNSLSRYENGTSSVSTELIDIICQKFNVSYVDI
VGEDKMLNPVEDYELTLKIEIVKERGANLLSRLYRYQDSQGISIDDESNPWILMSDDLSD
LIHTNIYLVETFDEIERYSGYLDGIERMLEISEKRMVA
Download sequence
Identical sequences A0A098API9 Q97QZ2
gi|15900920|ref|NP_345524.1| WP_000579608.1.101407 WP_000579608.1.10295 WP_000579608.1.10337 WP_000579608.1.10932 WP_000579608.1.11328 WP_000579608.1.11622 WP_000579608.1.12134 WP_000579608.1.12723 WP_000579608.1.13729 WP_000579608.1.14260 WP_000579608.1.14347 WP_000579608.1.15305 WP_000579608.1.15854 WP_000579608.1.1672 WP_000579608.1.16884 WP_000579608.1.17063 WP_000579608.1.1846 WP_000579608.1.18488 WP_000579608.1.18555 WP_000579608.1.20207 WP_000579608.1.20984 WP_000579608.1.21377 WP_000579608.1.21781 WP_000579608.1.22506 WP_000579608.1.22591 WP_000579608.1.23659 WP_000579608.1.24098 WP_000579608.1.24724 WP_000579608.1.25791 WP_000579608.1.26807 WP_000579608.1.26877 WP_000579608.1.28708 WP_000579608.1.28772 WP_000579608.1.28931 WP_000579608.1.29323 WP_000579608.1.30167 WP_000579608.1.30243 WP_000579608.1.30757 WP_000579608.1.30942 WP_000579608.1.3211 WP_000579608.1.32644 WP_000579608.1.32771 WP_000579608.1.33091 WP_000579608.1.33891 WP_000579608.1.35218 WP_000579608.1.36795 WP_000579608.1.36982 WP_000579608.1.37194 WP_000579608.1.39071 WP_000579608.1.39318 WP_000579608.1.40558 WP_000579608.1.41958 WP_000579608.1.42358 WP_000579608.1.42625 WP_000579608.1.4366 WP_000579608.1.43714 WP_000579608.1.46060 WP_000579608.1.46088 WP_000579608.1.4621 WP_000579608.1.48614 WP_000579608.1.48731 WP_000579608.1.50089 WP_000579608.1.52386 WP_000579608.1.53600 WP_000579608.1.54458 WP_000579608.1.54563 WP_000579608.1.55211 WP_000579608.1.55479 WP_000579608.1.57787 WP_000579608.1.5941 WP_000579608.1.61151 WP_000579608.1.61220 WP_000579608.1.61307 WP_000579608.1.61506 WP_000579608.1.61959 WP_000579608.1.64373 WP_000579608.1.64890 WP_000579608.1.65126 WP_000579608.1.65268 WP_000579608.1.6577 WP_000579608.1.67515 WP_000579608.1.68578 WP_000579608.1.68660 WP_000579608.1.69017 WP_000579608.1.69752 WP_000579608.1.70110 WP_000579608.1.71360 WP_000579608.1.72071 WP_000579608.1.72082 WP_000579608.1.72472 WP_000579608.1.72628 WP_000579608.1.72854 WP_000579608.1.73214 WP_000579608.1.73939 WP_000579608.1.74033 WP_000579608.1.74260 WP_000579608.1.76264 WP_000579608.1.77223 WP_000579608.1.78379 WP_000579608.1.78535 WP_000579608.1.78866 WP_000579608.1.80228 WP_000579608.1.82652 WP_000579608.1.83974 WP_000579608.1.84897 WP_000579608.1.86061 WP_000579608.1.8655 WP_000579608.1.89645 WP_000579608.1.90319 WP_000579608.1.90502 WP_000579608.1.90603 WP_000579608.1.91358 WP_000579608.1.92344 WP_000579608.1.93178 WP_000579608.1.93878 WP_000579608.1.94391 WP_000579608.1.95104 WP_000579608.1.95765 WP_000579608.1.95868 WP_000579608.1.97994 WP_000579608.1.99203 WP_000579608.1.99628 2p5t_A 2p5t_C 2p5t_E 2p5t_G 170187.SP_1050 APC80399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]