SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2xj3_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2xj3_A
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.31e-20
Family SinR domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2xj3_A
Sequence length 66
Comment mol:protein length:66 CYLR2 SYNONYM CYTOLYSIN REPRESSOR 2
Sequence
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi
fqwqpe
Download sequence
Identical sequences 2xiu_A 2xiu_B 2xj3_A 2xj3_B 000412678|e2xiuA1|101.1.4.64|A:1-66 000412680|e2xj3A1|101.1.4.64|A:1-66 000412681|e2xj3B1|101.1.4.64|B:1-66 cath|current|2xiuA00/1-66 cath|current|2xiuB00/1-65 cath|current|2xj3A00/1-66 cath|current|2xj3B00/1-66 d2xiua_ d2xj3a_ d2xj3b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]