SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2zw4_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2zw4_C
Domain Number 1 Region: 12-166
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.02e-34
Family N-acetyl transferase, NAT 0.027
Further Details:      
 
Domain Number 2 Region: 187-300
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.00000000000575
Family SCOPe 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2zw4_C
Sequence length 301
Comment mol:protein length:301 Bleomycin acetyltransferase
Sequence
MTEHPRAHTAHLRTARLELTPLDPAADARHLHHAYGDEEVMRWWTRPACADPAETERYLT
SCAAAPGARLWTIRAPDGTVPGMAGLLGGTDVPGLTWLLRRDSWGHGYATEAAAAVVGHA
LEDGGLDRVEAWIEAGNRRSLAVAARVGLTERARLAQHYPHRPGPHEMVVLGKARAEEPL
TTLAVITELPVRDVAATLRLVEAALGARTAFAIGDPPEFAEAALTPWSAGPRFRLAAVPG
PGPVEPVRLHLDAAGTADSLHRRAVDAGARVDGPPVRRPWGRSEFVITLPEGHELTVSAP
V
Download sequence
Identical sequences Q53796
2zw4_A 2zw4_B 2zw4_C 2zw4_D 2zw5_A 2zw5_B 2zw6_A 2zw6_B 2zw7_A 2zw7_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]