SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3d1n_M from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3d1n_M
Domain Number 1 Region: 4-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.5e-53
Family POU-specific domain 0.02
Further Details:      
 
Domain Number 2 Region: 89-146
Classification Level Classification E-value
Superfamily Homeodomain-like 4.1e-22
Family Homeodomain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3d1n_M
Sequence length 151
Comment mol:protein length:151 POU domain, class 6, transcription factor 1
Sequence
inmeeirefaknfkirrlslgltqtqvgqamtategpaysqsaisrfeklditpksaqkl
kpvlekwlneaelrnqegqqnlmefvggepskkrkrrtsftpqaiealnayfeknplptg
qeitemakelnydrevvrvwfsnrrqtlknt
Download sequence
Identical sequences 3d1n_I 3d1n_J 3d1n_K 3d1n_L 3d1n_M 3d1n_N 3d1n_O 3d1n_P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]