SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3e3m_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3e3m_A
Domain Number 1 Region: 67-339
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.84e-71
Family SCOPe 0.0000000048
Further Details:      
 
Domain Number 2 Region: 13-58
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.05e-23
Family GalR/LacI-like bacterial regulator 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3e3m_A
Sequence length 355
Comment mol:protein length:355 Transcriptional regulator, LacI family
Sequence
msldsrkpghrpvtmrdvakaagvsrmtvsralkkdspissetrerilkvvkdmnyvpdq
vagslttkrsgfvglllpslnnlhfaqtaqsltdvleqgglqlllgytayspereeqlve
tmlrrrpeamvlsydghteqtirllqrasipiveiwekpahpightvgfsneraaydmtn
allargfrkivflgekdddwtrgaarragfkramreaglnpdqeirlgapplsiedgvaa
aelilqeypdtdcifcvsdmpafgllsrlksigvavpeqvsvvgfgnfevsrfaspeist
vrvdpiaigretgslilrlldpkqrspqtaqhitlppvlefrpslkneghhhhhh
Download sequence
Identical sequences 3e3m_A 3e3m_B 3e3m_C 3e3m_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]