SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3f52_E from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3f52_E
Domain Number 1 Region: 23-90
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000105
Family SinR domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3f52_E
Sequence length 117
Comment mol:protein length:117 clp gene regulator (ClgR)
Sequence
mvtyttlldkpisesaprkapepllrealgaalrsfradkgvtlrelaeasrvspgylse
lergrkevssellasvchalgasvadvlieaagsmalqaaqedlarvlewshpqfek
Download sequence
Identical sequences 3f51_A 3f51_B 3f51_C 3f51_D 3f51_E 3f51_F 3f52_A 3f52_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]