SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3gn5_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3gn5_A
Domain Number 1 Region: 71-128
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000033
Family Phage repressors 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3gn5_A
Sequence length 133
Comment mol:protein length:133 HTH-type transcriptional regulator MQSA (YGIT/b3021)
Sequence
ghmkcpvchqgemvsgikdipytfrgrktvlkgihglycvhceesimnkeesdafmaqvk
afrasvnaetvapefivkvrkklsltqkeaseifgggvnafsryekgnaqphpstikllr
vldkhpellneir
Download sequence
Identical sequences 3gn5_A 3gn5_B 3o9x_A 3o9x_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]