SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3h5o_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3h5o_B
Domain Number 1 Region: 64-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.08e-77
Family SCOPe 0.00000000293
Further Details:      
 
Domain Number 2 Region: 5-50
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.29e-21
Family GalR/LacI-like bacterial regulator 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3h5o_B
Sequence length 339
Comment mol:protein length:339 Transcriptional regulator GntR
Sequence
mslgvtmhdvakaagvsaitvsrvlnqpqqvseqlrekvmqavdalayvpsrsastlasa
ksrtvlvlipslantvfletltgietvldaagyqmlignshydagqelqllraylqhrpd
gvlitglshaepferilsqhalpvvymmdladdgrccvgfsqedagaaitrhllsrgkrr
igflgaqldervmkrldgyraaldaadcrdaglewldpqpssmqmgadmldralaerpdc
dalfccnddlaigalarsqqlgiavperlaiagfndlqpaawctpplttvatprrdigvh
aakallqlidgeepasrradlgfrlmlrrsseghhhhhh
Download sequence
Identical sequences 3h5o_A 3h5o_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]