SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3ivp_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3ivp_B
Domain Number 1 Region: 10-75
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000544
Family SinR domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3ivp_B
Sequence length 126
Comment mol:protein length:126 Putative transposon-related DNA-binding protein
Sequence
mrkkedkydfralglaikearkkqgltreqvgamieidpryltnienkgqhpslqvlydl
vsllnvsvdefflpassqvkstkrrqlenkidnftdadlvimesvadgivkskevgemag
enlyfq
Download sequence
Identical sequences 3ivp_A 3ivp_B 3ivp_C 3ivp_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]