SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3jxb_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3jxb_C
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.65e-16
Family Phage repressors 0.0000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3jxb_C
Sequence length 67
Comment mol:protein length:67 Repressor protein C2
Sequence
ntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcsp
dyllkgd
Download sequence
Identical sequences 3jxb_C 3jxb_D 3jxc_L 3jxc_R 3jxd_L 3jxd_R 000137778|e3jxbC1|101.1.4.66|C:1-67 cath|current|3jxbC00/2-68 cath|current|3jxbD00/4-68 cath|current|3jxcL00/3-68 cath|current|3jxcR00/3-68 cath|current|3jxdL00/3-68 cath|current|3jxdR00/3-68 d3jxbc_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]