SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3kxa_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3kxa_B
Domain Number 1 Region: 70-127
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000906
Family SinR domain-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3kxa_B
Sequence length 141
Comment mol:protein length:141 Putative uncharacterized protein
Sequence
mahhhhhhipvthikclringqikcvkpispnttpaaehiehvrknprrkaamdraaari
adkialkaggetfvslrmkkgftqselataaglpqpylsrienskqslqdktvqklanal
gvsplevraaferryeymeqa
Download sequence
Identical sequences 3kxa_A 3kxa_B 3kxa_C 3kxa_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]