SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3mlf_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3mlf_C
Domain Number 1 Region: 26-91
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000061
Family SinR domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3mlf_C
Sequence length 111
Comment mol:protein length:111 transcriptional regulator
Sequence
mhhhhhhssgvdlgtenlyfqsnamktlkelrtdygltqkelgdlfkvssrtiqnmekds
tnikdsllskymsafnvkyddiflgneyenfvftndkkksiilafkekqts
Download sequence
Identical sequences 3mlf_A 3mlf_B 3mlf_C 3mlf_D 3mlf_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]