SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3oqo_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3oqo_C
Domain Number 1 Region: 62-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.09e-118
Family SCOPe 0.0000304
Further Details:      
 
Domain Number 2 Region: 4-48
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.42e-29
Family GalR/LacI-like bacterial regulator 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3oqo_C
Sequence length 339
Comment mol:protein length:339 Catabolite control protein A
Sequence
mnitiydvareanvsmatvsrvvngnpnvkpttrkkvleaierlgyrpnavarglaskkt
ttvgviipdissifyselargiediatmykyniilsnsdqnmekelhllntmlgkqvdgi
vfmggnitdehvaefkrspvpivlaasveeqeetpsvaidyeqaiydavkllvdkghtdi
afvsgpmaepinrskklqgykraleeanlpfneqfvaegdytydsglealqhlmsldkkp
tailsatdemalgiihaaqdqglsipedldiigfdntrlslmvrpqlstvvqptydigav
amrlltklmnkepveehivelphrielrkstkahhhhhh
Download sequence
Identical sequences 3oqo_A 3oqo_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]