SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3qax_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3qax_B
Domain Number 1 Region: 34-251
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.5e-47
Family SCOPe 0.000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3qax_B
Sequence length 268
Comment mol:protein length:268 Probable ABC transporter arginine-binding protein ArtJ
Sequence
mikqigrffrafifimplsltsceskidrnriwivgtnatyppfeyvdaqgevvgfdidl
akaiseklgkqlevrefafdalilnlkkhridailagmsitpsrqkeiallpyygdevqe
lmvvskrsletpvlpltqyssvavqtgtyqehyllsqpgicvrsfdstlevimevrygks
pvavlepsvgrvvlkdfpnlvatrlelppecwvlgcglgvakdrpeeiqtiqqaitdlks
egviqsltkkwqlsevayeaaqvwghtp
Download sequence
Identical sequences 3qax_A 3qax_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]