SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3trb_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3trb_A
Domain Number 1 Region: 13-96
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.45e-23
Family SinR domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3trb_A
Sequence length 104
Comment mol:protein length:104 Virulence-associated protein I
Sequence
snamaanrmrpihpgeilaeelgfldkmsanqlakhlaiptnrvtailngarsitadtal
rlakffgttpefwlnlqdaydikmalkksgkkiekevtpydqaa
Download sequence
Identical sequences 3trb_A 3trb_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]