SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3vk0_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3vk0_A
Domain Number 1 Region: 17-83
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000158
Family SinR domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3vk0_A
Sequence length 114
Comment mol:protein length:114 Transcriptional regulator
Sequence
mmgnkltlpaelpdeqdlravlaynmrlfrvnkgwsqeelarqcgldrtyvsaverkrwn
ialsniekmaaalgvaayqlllppqerlklmtnsadtrqmpsesgilehhhhhh
Download sequence
Identical sequences 3vk0_A 3vk0_B 3vk0_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]