SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3zkc_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3zkc_A
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.2e-18
Family SinR domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 74-107
Classification Level Classification E-value
Superfamily SinR repressor dimerisation domain-like 0.00000000000102
Family SinR repressor dimerisation domain-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3zkc_A
Sequence length 111
Comment mol:protein length:111 HTH-TYPE TRANSCRIPTIONAL REGULATOR SINR
Sequence
MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHT
LLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQKEE
Download sequence
Identical sequences A0A1V4FYB6 A0A268DRM9 A0A2A2VYQ6 A0A2C6F5F2 A0A2I7SXA3 E0U3H4 L8ANI5 P06533
gi|470162668|ref|YP_007534443.1| cath|current|1b0nA00/1-108 1b0n_A 3zkc_A 3zkc_B gi|472330846|ref|YP_007663122.1| NP_390341.1.22788 WP_003226345.1.100042 WP_003226345.1.101301 WP_003226345.1.101446 WP_003226345.1.11088 WP_003226345.1.11231 WP_003226345.1.11257 WP_003226345.1.1140 WP_003226345.1.11581 WP_003226345.1.12644 WP_003226345.1.12759 WP_003226345.1.1358 WP_003226345.1.14761 WP_003226345.1.15902 WP_003226345.1.16291 WP_003226345.1.17079 WP_003226345.1.1831 WP_003226345.1.18944 WP_003226345.1.19261 WP_003226345.1.19287 WP_003226345.1.20099 WP_003226345.1.20502 WP_003226345.1.21045 WP_003226345.1.22408 WP_003226345.1.23108 WP_003226345.1.2546 WP_003226345.1.25531 WP_003226345.1.27155 WP_003226345.1.27612 WP_003226345.1.27660 WP_003226345.1.2914 WP_003226345.1.30885 WP_003226345.1.31028 WP_003226345.1.31100 WP_003226345.1.31260 WP_003226345.1.32001 WP_003226345.1.32025 WP_003226345.1.32219 WP_003226345.1.32420 WP_003226345.1.32693 WP_003226345.1.32861 WP_003226345.1.33083 WP_003226345.1.3320 WP_003226345.1.33285 WP_003226345.1.33846 WP_003226345.1.34242 WP_003226345.1.34322 WP_003226345.1.34621 WP_003226345.1.34750 WP_003226345.1.35833 WP_003226345.1.35907 WP_003226345.1.36189 WP_003226345.1.37074 WP_003226345.1.3747 WP_003226345.1.39562 WP_003226345.1.39605 WP_003226345.1.40844 WP_003226345.1.40859 WP_003226345.1.42762 WP_003226345.1.44184 WP_003226345.1.45019 WP_003226345.1.46869 WP_003226345.1.47672 WP_003226345.1.48147 WP_003226345.1.50592 WP_003226345.1.51783 WP_003226345.1.5262 WP_003226345.1.52847 WP_003226345.1.52860 WP_003226345.1.54948 WP_003226345.1.54949 WP_003226345.1.55792 WP_003226345.1.56085 WP_003226345.1.56274 WP_003226345.1.56411 WP_003226345.1.57156 WP_003226345.1.57184 WP_003226345.1.57201 WP_003226345.1.5726 WP_003226345.1.57513 WP_003226345.1.59841 WP_003226345.1.6139 WP_003226345.1.62713 WP_003226345.1.63795 WP_003226345.1.64557 WP_003226345.1.64889 WP_003226345.1.6517 WP_003226345.1.65188 WP_003226345.1.65223 WP_003226345.1.65841 WP_003226345.1.67028 WP_003226345.1.67974 WP_003226345.1.71361 WP_003226345.1.71402 WP_003226345.1.7159 WP_003226345.1.71834 WP_003226345.1.7186 WP_003226345.1.71916 WP_003226345.1.7204 WP_003226345.1.72152 WP_003226345.1.72516 WP_003226345.1.72999 WP_003226345.1.73612 WP_003226345.1.74782 WP_003226345.1.76814 WP_003226345.1.76977 WP_003226345.1.77994 WP_003226345.1.78686 WP_003226345.1.78811 WP_003226345.1.79046 WP_003226345.1.79288 WP_003226345.1.79633 WP_003226345.1.79712 WP_003226345.1.79987 WP_003226345.1.80832 WP_003226345.1.81116 WP_003226345.1.81747 WP_003226345.1.82722 WP_003226345.1.82789 WP_003226345.1.83369 WP_003226345.1.84183 WP_003226345.1.84434 WP_003226345.1.84556 WP_003226345.1.87192 WP_003226345.1.87300 WP_003226345.1.88042 WP_003226345.1.88382 WP_003226345.1.88591 WP_003226345.1.89000 WP_003226345.1.89821 WP_003226345.1.90368 WP_003226345.1.90830 WP_003226345.1.91060 WP_003226345.1.91225 WP_003226345.1.9164 WP_003226345.1.91723 WP_003226345.1.92915 WP_003226345.1.93073 WP_003226345.1.93400 WP_003226345.1.93420 WP_003226345.1.93618 WP_003226345.1.94199 WP_003226345.1.95009 WP_003226345.1.95211 WP_003226345.1.95507 WP_003226345.1.96043 WP_003226345.1.97264 WP_003226345.1.979 WP_003226345.1.99091 WP_003226345.1.99399 gi|16079517|ref|NP_390341.1| 224308.BSU24610 gi|305675112|ref|YP_003866784.1| 1b0nA gi|321311945|ref|YP_004204232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]