SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4cro_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4cro_B
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.76e-29
Family Phage repressors 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4cro_B
Sequence length 66
Comment mol:protein length:66 PROTEIN (LAMBDA CRO)
Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPS
NKKTTA
Download sequence
Identical sequences A0A0D1PGM9 A0A0D7C8H1 A0A0E0V2S6 A0A0E2TKJ7 A0A0F6BZB5 A0A0F6F1A8 A0A0H3JDH5 A0A0K2FI72 A0A1C0UN69 A0A1S1V5V0 A0A1X3LME2 A0A1X8W452 A0A1Z3UVD8 A0A2D0NV35 A0A2G1VLI0 A0A2H6KN93 A2SY74 A4KWR4 A4KWS1 A4KWS9 A4KWT7 A4KWU4 B7UG51 E3XJ82 H4I897 H4INR9 H4J427 H4L995 I2RN07 M1FQU4 P03040 X5KG84
2001340508 5croA gi|386623408|ref|YP_006143136.1| 2016922849 A2SY74_LAMBD A4KWR4_9VIRU A4KWS1_9VIRU A4KWS9_9VIRU A4KWT7_9VIRU A4KWU4_9VIRU RCRO_LAMBD gi|238903102|ref|YP_002928898.1| 386585.ECs0275 444450.ECH74115_0294 544404.ECSP_0284 574521.E2348C_2533 595496.BWG_3704 gi|215487606|ref|YP_002330037.1| cath|current|1copD00/1-66 cath|current|1copE00/1-66 cath|current|5croA00/1-61 cath|current|5croB00/1-61 cath|current|5croC00/1-61 cath|current|5croO00/1-60 d1copd_ d1cope_ NP_040629.1.28658 NP_308302.1.58667 WP_000437875.1.1000 WP_000437875.1.10001 WP_000437875.1.100073 WP_000437875.1.10010 WP_000437875.1.100283 WP_000437875.1.100299 WP_000437875.1.100302 WP_000437875.1.100508 WP_000437875.1.100554 WP_000437875.1.100950 WP_000437875.1.101105 WP_000437875.1.101110 WP_000437875.1.101166 WP_000437875.1.101206 WP_000437875.1.101486 WP_000437875.1.101518 WP_000437875.1.101628 WP_000437875.1.101727 WP_000437875.1.101865 WP_000437875.1.101969 WP_000437875.1.101987 WP_000437875.1.102036 WP_000437875.1.10206 WP_000437875.1.102094 WP_000437875.1.102139 WP_000437875.1.10252 WP_000437875.1.10335 WP_000437875.1.10491 WP_000437875.1.10761 WP_000437875.1.10787 WP_000437875.1.10970 WP_000437875.1.10994 WP_000437875.1.11032 WP_000437875.1.1111 WP_000437875.1.11240 WP_000437875.1.11270 WP_000437875.1.11301 WP_000437875.1.11420 WP_000437875.1.11671 WP_000437875.1.11690 WP_000437875.1.12305 WP_000437875.1.12552 WP_000437875.1.12582 WP_000437875.1.12717 WP_000437875.1.12743 WP_000437875.1.12756 WP_000437875.1.12762 WP_000437875.1.13060 WP_000437875.1.13217 WP_000437875.1.13223 WP_000437875.1.13332 WP_000437875.1.13430 WP_000437875.1.13442 WP_000437875.1.13881 WP_000437875.1.13974 WP_000437875.1.14746 WP_000437875.1.14748 WP_000437875.1.14833 WP_000437875.1.15041 WP_000437875.1.15087 WP_000437875.1.15193 WP_000437875.1.15356 WP_000437875.1.15503 WP_000437875.1.15523 WP_000437875.1.15527 WP_000437875.1.15583 WP_000437875.1.15702 WP_000437875.1.1582 WP_000437875.1.15869 WP_000437875.1.16014 WP_000437875.1.16075 WP_000437875.1.16086 WP_000437875.1.16133 WP_000437875.1.16183 WP_000437875.1.16222 WP_000437875.1.16272 WP_000437875.1.16463 WP_000437875.1.16481 WP_000437875.1.16845 WP_000437875.1.17102 WP_000437875.1.17187 WP_000437875.1.17241 WP_000437875.1.17415 WP_000437875.1.17515 WP_000437875.1.17550 WP_000437875.1.17766 WP_000437875.1.17904 WP_000437875.1.18136 WP_000437875.1.18164 WP_000437875.1.18316 WP_000437875.1.18326 WP_000437875.1.1834 WP_000437875.1.18340 WP_000437875.1.18461 WP_000437875.1.18519 WP_000437875.1.18666 WP_000437875.1.18801 WP_000437875.1.1881 WP_000437875.1.18837 WP_000437875.1.18861 WP_000437875.1.18914 WP_000437875.1.18995 WP_000437875.1.19100 WP_000437875.1.19140 WP_000437875.1.19153 WP_000437875.1.19778 WP_000437875.1.19830 WP_000437875.1.19847 WP_000437875.1.19878 WP_000437875.1.2005 WP_000437875.1.20139 WP_000437875.1.20449 WP_000437875.1.20546 WP_000437875.1.20594 WP_000437875.1.2060 WP_000437875.1.20693 WP_000437875.1.20737 WP_000437875.1.20745 WP_000437875.1.20863 WP_000437875.1.2089 WP_000437875.1.20893 WP_000437875.1.20936 WP_000437875.1.20941 WP_000437875.1.20950 WP_000437875.1.2100 WP_000437875.1.21236 WP_000437875.1.21426 WP_000437875.1.21668 WP_000437875.1.21824 WP_000437875.1.21909 WP_000437875.1.2218 WP_000437875.1.22251 WP_000437875.1.22304 WP_000437875.1.22497 WP_000437875.1.22574 WP_000437875.1.22662 WP_000437875.1.22690 WP_000437875.1.22925 WP_000437875.1.23073 WP_000437875.1.23115 WP_000437875.1.23241 WP_000437875.1.23323 WP_000437875.1.23467 WP_000437875.1.23746 WP_000437875.1.23790 WP_000437875.1.23838 WP_000437875.1.23899 WP_000437875.1.23973 WP_000437875.1.23984 WP_000437875.1.24122 WP_000437875.1.2428 WP_000437875.1.24283 WP_000437875.1.24290 WP_000437875.1.2430 WP_000437875.1.24341 WP_000437875.1.24752 WP_000437875.1.24876 WP_000437875.1.24929 WP_000437875.1.25050 WP_000437875.1.25076 WP_000437875.1.25082 WP_000437875.1.25088 WP_000437875.1.25201 WP_000437875.1.25305 WP_000437875.1.25420 WP_000437875.1.25577 WP_000437875.1.25794 WP_000437875.1.25819 WP_000437875.1.25831 WP_000437875.1.26066 WP_000437875.1.26105 WP_000437875.1.26121 WP_000437875.1.26134 WP_000437875.1.26291 WP_000437875.1.26474 WP_000437875.1.26525 WP_000437875.1.26878 WP_000437875.1.26943 WP_000437875.1.26950 WP_000437875.1.26975 WP_000437875.1.26998 WP_000437875.1.27043 WP_000437875.1.27313 WP_000437875.1.27445 WP_000437875.1.27580 WP_000437875.1.27691 WP_000437875.1.27923 WP_000437875.1.28026 WP_000437875.1.2811 WP_000437875.1.28143 WP_000437875.1.28250 WP_000437875.1.28401 WP_000437875.1.28508 WP_000437875.1.28551 WP_000437875.1.28734 WP_000437875.1.28829 WP_000437875.1.28879 WP_000437875.1.291 WP_000437875.1.29126 WP_000437875.1.29497 WP_000437875.1.29564 WP_000437875.1.29597 WP_000437875.1.29618 WP_000437875.1.2978 WP_000437875.1.29818 WP_000437875.1.29874 WP_000437875.1.29976 WP_000437875.1.30019 WP_000437875.1.30052 WP_000437875.1.30064 WP_000437875.1.30123 WP_000437875.1.30164 WP_000437875.1.30476 WP_000437875.1.30550 WP_000437875.1.30637 WP_000437875.1.30918 WP_000437875.1.30993 WP_000437875.1.31055 WP_000437875.1.31252 WP_000437875.1.3140 WP_000437875.1.31401 WP_000437875.1.31696 WP_000437875.1.31715 WP_000437875.1.31956 WP_000437875.1.32063 WP_000437875.1.32121 WP_000437875.1.322 WP_000437875.1.32234 WP_000437875.1.32243 WP_000437875.1.32356 WP_000437875.1.32480 WP_000437875.1.32536 WP_000437875.1.32561 WP_000437875.1.32574 WP_000437875.1.32587 WP_000437875.1.32590 WP_000437875.1.32724 WP_000437875.1.32888 WP_000437875.1.32931 WP_000437875.1.32946 WP_000437875.1.32972 WP_000437875.1.32984 WP_000437875.1.33061 WP_000437875.1.33094 WP_000437875.1.33125 WP_000437875.1.33146 WP_000437875.1.33167 WP_000437875.1.33268 WP_000437875.1.33424 WP_000437875.1.34383 WP_000437875.1.34456 WP_000437875.1.34470 WP_000437875.1.34680 WP_000437875.1.34686 WP_000437875.1.34763 WP_000437875.1.35012 WP_000437875.1.35368 WP_000437875.1.3550 WP_000437875.1.35632 WP_000437875.1.36010 WP_000437875.1.36212 WP_000437875.1.36626 WP_000437875.1.36767 WP_000437875.1.37102 WP_000437875.1.37372 WP_000437875.1.37433 WP_000437875.1.37588 WP_000437875.1.3762 WP_000437875.1.37731 WP_000437875.1.37847 WP_000437875.1.37858 WP_000437875.1.37918 WP_000437875.1.38050 WP_000437875.1.38063 WP_000437875.1.38105 WP_000437875.1.38107 WP_000437875.1.38119 WP_000437875.1.38306 WP_000437875.1.38357 WP_000437875.1.38722 WP_000437875.1.389 WP_000437875.1.38958 WP_000437875.1.39171 WP_000437875.1.39216 WP_000437875.1.39302 WP_000437875.1.39310 WP_000437875.1.39415 WP_000437875.1.39564 WP_000437875.1.39601 WP_000437875.1.39636 WP_000437875.1.39646 WP_000437875.1.39726 WP_000437875.1.39820 WP_000437875.1.40113 WP_000437875.1.40234 WP_000437875.1.4030 WP_000437875.1.40315 WP_000437875.1.40317 WP_000437875.1.40335 WP_000437875.1.40389 WP_000437875.1.40549 WP_000437875.1.40629 WP_000437875.1.40742 WP_000437875.1.40793 WP_000437875.1.40842 WP_000437875.1.40882 WP_000437875.1.40900 WP_000437875.1.40952 WP_000437875.1.4103 WP_000437875.1.41330 WP_000437875.1.41402 WP_000437875.1.41478 WP_000437875.1.41484 WP_000437875.1.41488 WP_000437875.1.41734 WP_000437875.1.41784 WP_000437875.1.41813 WP_000437875.1.41849 WP_000437875.1.41885 WP_000437875.1.41964 WP_000437875.1.41990 WP_000437875.1.42033 WP_000437875.1.42036 WP_000437875.1.42151 WP_000437875.1.42447 WP_000437875.1.42456 WP_000437875.1.4250 WP_000437875.1.42513 WP_000437875.1.42516 WP_000437875.1.4261 WP_000437875.1.42863 WP_000437875.1.43079 WP_000437875.1.4313 WP_000437875.1.43140 WP_000437875.1.43196 WP_000437875.1.43384 WP_000437875.1.43448 WP_000437875.1.43536 WP_000437875.1.43754 WP_000437875.1.43798 WP_000437875.1.43837 WP_000437875.1.43939 WP_000437875.1.44115 WP_000437875.1.44125 WP_000437875.1.44335 WP_000437875.1.44488 WP_000437875.1.44570 WP_000437875.1.44601 WP_000437875.1.44733 WP_000437875.1.44872 WP_000437875.1.44906 WP_000437875.1.44954 WP_000437875.1.45020 WP_000437875.1.45076 WP_000437875.1.4515 WP_000437875.1.45195 WP_000437875.1.45293 WP_000437875.1.45565 WP_000437875.1.45575 WP_000437875.1.4583 WP_000437875.1.45841 WP_000437875.1.45901 WP_000437875.1.45941 WP_000437875.1.46158 WP_000437875.1.4619 WP_000437875.1.46282 WP_000437875.1.46283 WP_000437875.1.46369 WP_000437875.1.46414 WP_000437875.1.46451 WP_000437875.1.46503 WP_000437875.1.4656 WP_000437875.1.46589 WP_000437875.1.46597 WP_000437875.1.46611 WP_000437875.1.46810 WP_000437875.1.46913 WP_000437875.1.47029 WP_000437875.1.47048 WP_000437875.1.4708 WP_000437875.1.47140 WP_000437875.1.47156 WP_000437875.1.47224 WP_000437875.1.4723 WP_000437875.1.47411 WP_000437875.1.47634 WP_000437875.1.47784 WP_000437875.1.47827 WP_000437875.1.47954 WP_000437875.1.47994 WP_000437875.1.48018 WP_000437875.1.4812 WP_000437875.1.48176 WP_000437875.1.48188 WP_000437875.1.48226 WP_000437875.1.48258 WP_000437875.1.48385 WP_000437875.1.48480 WP_000437875.1.48686 WP_000437875.1.48697 WP_000437875.1.48712 WP_000437875.1.48792 WP_000437875.1.48806 WP_000437875.1.48953 WP_000437875.1.49076 WP_000437875.1.49243 WP_000437875.1.4931 WP_000437875.1.49332 WP_000437875.1.49401 WP_000437875.1.49464 WP_000437875.1.49567 WP_000437875.1.49733 WP_000437875.1.49788 WP_000437875.1.50078 WP_000437875.1.50110 WP_000437875.1.50179 WP_000437875.1.50345 WP_000437875.1.50358 WP_000437875.1.50717 WP_000437875.1.50725 WP_000437875.1.50762 WP_000437875.1.50986 WP_000437875.1.51058 WP_000437875.1.51154 WP_000437875.1.51171 WP_000437875.1.51283 WP_000437875.1.51505 WP_000437875.1.51552 WP_000437875.1.51693 WP_000437875.1.51834 WP_000437875.1.52039 WP_000437875.1.52270 WP_000437875.1.52333 WP_000437875.1.52496 WP_000437875.1.52543 WP_000437875.1.52662 WP_000437875.1.5277 WP_000437875.1.52933 WP_000437875.1.53084 WP_000437875.1.53123 WP_000437875.1.53181 WP_000437875.1.53211 WP_000437875.1.5322 WP_000437875.1.53252 WP_000437875.1.5467 WP_000437875.1.5478 WP_000437875.1.54817 WP_000437875.1.54883 WP_000437875.1.55197 WP_000437875.1.55218 WP_000437875.1.55730 WP_000437875.1.55757 WP_000437875.1.55820 WP_000437875.1.55838 WP_000437875.1.55892 WP_000437875.1.55897 WP_000437875.1.55995 WP_000437875.1.56164 WP_000437875.1.5639 WP_000437875.1.56392 WP_000437875.1.56481 WP_000437875.1.56489 WP_000437875.1.56491 WP_000437875.1.56554 WP_000437875.1.56571 WP_000437875.1.56665 WP_000437875.1.56742 WP_000437875.1.56821 WP_000437875.1.57032 WP_000437875.1.57071 WP_000437875.1.57180 WP_000437875.1.57453 WP_000437875.1.57466 WP_000437875.1.5748 WP_000437875.1.57605 WP_000437875.1.57610 WP_000437875.1.5764 WP_000437875.1.57646 WP_000437875.1.58048 WP_000437875.1.58057 WP_000437875.1.58060 WP_000437875.1.58080 WP_000437875.1.58169 WP_000437875.1.58238 WP_000437875.1.58289 WP_000437875.1.584 WP_000437875.1.58408 WP_000437875.1.58420 WP_000437875.1.58423 WP_000437875.1.5852 WP_000437875.1.58707 WP_000437875.1.58723 WP_000437875.1.58870 WP_000437875.1.58901 WP_000437875.1.59038 WP_000437875.1.59306 WP_000437875.1.59374 WP_000437875.1.59409 WP_000437875.1.59413 WP_000437875.1.59470 WP_000437875.1.59491 WP_000437875.1.59590 WP_000437875.1.59877 WP_000437875.1.59905 WP_000437875.1.60042 WP_000437875.1.60110 WP_000437875.1.60117 WP_000437875.1.60304 WP_000437875.1.60461 WP_000437875.1.60647 WP_000437875.1.60744 WP_000437875.1.60761 WP_000437875.1.60872 WP_000437875.1.6088 WP_000437875.1.6095 WP_000437875.1.60973 WP_000437875.1.61039 WP_000437875.1.61099 WP_000437875.1.61108 WP_000437875.1.61186 WP_000437875.1.61253 WP_000437875.1.61623 WP_000437875.1.61774 WP_000437875.1.618 WP_000437875.1.61874 WP_000437875.1.62182 WP_000437875.1.62273 WP_000437875.1.62480 WP_000437875.1.62487 WP_000437875.1.62675 WP_000437875.1.62714 WP_000437875.1.62812 WP_000437875.1.62888 WP_000437875.1.6323 WP_000437875.1.6331 WP_000437875.1.63433 WP_000437875.1.63445 WP_000437875.1.63586 WP_000437875.1.63615 WP_000437875.1.6364 WP_000437875.1.63872 WP_000437875.1.64086 WP_000437875.1.64161 WP_000437875.1.64190 WP_000437875.1.64572 WP_000437875.1.6485 WP_000437875.1.64946 WP_000437875.1.65035 WP_000437875.1.65061 WP_000437875.1.65084 WP_000437875.1.65271 WP_000437875.1.65372 WP_000437875.1.65413 WP_000437875.1.65546 WP_000437875.1.65875 WP_000437875.1.65898 WP_000437875.1.65963 WP_000437875.1.65978 WP_000437875.1.65982 WP_000437875.1.66033 WP_000437875.1.66044 WP_000437875.1.66100 WP_000437875.1.66280 WP_000437875.1.66376 WP_000437875.1.66566 WP_000437875.1.6676 WP_000437875.1.66873 WP_000437875.1.66922 WP_000437875.1.66948 WP_000437875.1.67073 WP_000437875.1.67132 WP_000437875.1.67209 WP_000437875.1.67214 WP_000437875.1.67581 WP_000437875.1.67676 WP_000437875.1.6769 WP_000437875.1.67726 WP_000437875.1.67732 WP_000437875.1.67760 WP_000437875.1.67775 WP_000437875.1.67780 WP_000437875.1.68096 WP_000437875.1.68177 WP_000437875.1.68411 WP_000437875.1.68678 WP_000437875.1.68701 WP_000437875.1.6887 WP_000437875.1.69127 WP_000437875.1.69643 WP_000437875.1.69649 WP_000437875.1.69716 WP_000437875.1.69735 WP_000437875.1.69780 WP_000437875.1.69803 WP_000437875.1.69810 WP_000437875.1.69818 WP_000437875.1.70063 WP_000437875.1.70101 WP_000437875.1.70123 WP_000437875.1.70125 WP_000437875.1.70490 WP_000437875.1.70539 WP_000437875.1.70576 WP_000437875.1.70723 WP_000437875.1.71003 WP_000437875.1.71099 WP_000437875.1.71113 WP_000437875.1.71205 WP_000437875.1.71225 WP_000437875.1.71226 WP_000437875.1.71269 WP_000437875.1.71327 WP_000437875.1.71448 WP_000437875.1.71767 WP_000437875.1.71840 WP_000437875.1.72016 WP_000437875.1.72162 WP_000437875.1.72240 WP_000437875.1.72322 WP_000437875.1.72427 WP_000437875.1.72614 WP_000437875.1.72641 WP_000437875.1.72913 WP_000437875.1.73126 WP_000437875.1.73230 WP_000437875.1.73343 WP_000437875.1.73801 WP_000437875.1.73827 WP_000437875.1.73833 WP_000437875.1.7392 WP_000437875.1.73968 WP_000437875.1.7429 WP_000437875.1.74426 WP_000437875.1.7446 WP_000437875.1.74521 WP_000437875.1.75164 WP_000437875.1.7539 WP_000437875.1.75536 WP_000437875.1.75694 WP_000437875.1.7583 WP_000437875.1.75989 WP_000437875.1.76005 WP_000437875.1.7608 WP_000437875.1.7617 WP_000437875.1.76189 WP_000437875.1.76387 WP_000437875.1.76407 WP_000437875.1.76477 WP_000437875.1.76557 WP_000437875.1.76643 WP_000437875.1.76697 WP_000437875.1.76815 WP_000437875.1.76827 WP_000437875.1.77214 WP_000437875.1.77239 WP_000437875.1.77275 WP_000437875.1.77392 WP_000437875.1.77540 WP_000437875.1.77644 WP_000437875.1.77760 WP_000437875.1.7780 WP_000437875.1.77961 WP_000437875.1.7799 WP_000437875.1.7804 WP_000437875.1.78063 WP_000437875.1.784 WP_000437875.1.78593 WP_000437875.1.78611 WP_000437875.1.78888 WP_000437875.1.79065 WP_000437875.1.79172 WP_000437875.1.79343 WP_000437875.1.7940 WP_000437875.1.79414 WP_000437875.1.79528 WP_000437875.1.79563 WP_000437875.1.79576 WP_000437875.1.79715 WP_000437875.1.79749 WP_000437875.1.79764 WP_000437875.1.79868 WP_000437875.1.79965 WP_000437875.1.80071 WP_000437875.1.8011 WP_000437875.1.80309 WP_000437875.1.80330 WP_000437875.1.80499 WP_000437875.1.80577 WP_000437875.1.80578 WP_000437875.1.80606 WP_000437875.1.80753 WP_000437875.1.81070 WP_000437875.1.814 WP_000437875.1.81420 WP_000437875.1.81438 WP_000437875.1.81442 WP_000437875.1.81514 WP_000437875.1.81754 WP_000437875.1.81821 WP_000437875.1.81934 WP_000437875.1.81972 WP_000437875.1.81975 WP_000437875.1.82010 WP_000437875.1.82057 WP_000437875.1.82296 WP_000437875.1.82594 WP_000437875.1.82629 WP_000437875.1.82666 WP_000437875.1.8268 WP_000437875.1.82800 WP_000437875.1.82833 WP_000437875.1.82991 WP_000437875.1.83253 WP_000437875.1.83384 WP_000437875.1.83415 WP_000437875.1.83680 WP_000437875.1.83712 WP_000437875.1.84219 WP_000437875.1.84221 WP_000437875.1.84264 WP_000437875.1.84312 WP_000437875.1.84482 WP_000437875.1.84635 WP_000437875.1.84657 WP_000437875.1.8477 WP_000437875.1.84977 WP_000437875.1.85138 WP_000437875.1.85175 WP_000437875.1.8530 WP_000437875.1.85435 WP_000437875.1.85500 WP_000437875.1.85722 WP_000437875.1.85772 WP_000437875.1.86016 WP_000437875.1.86166 WP_000437875.1.86171 WP_000437875.1.86225 WP_000437875.1.86266 WP_000437875.1.86340 WP_000437875.1.86364 WP_000437875.1.86376 WP_000437875.1.8652 WP_000437875.1.86574 WP_000437875.1.86994 WP_000437875.1.8711 WP_000437875.1.87382 WP_000437875.1.87563 WP_000437875.1.87607 WP_000437875.1.87616 WP_000437875.1.87990 WP_000437875.1.88119 WP_000437875.1.88147 WP_000437875.1.88197 WP_000437875.1.88427 WP_000437875.1.8843 WP_000437875.1.8848 WP_000437875.1.88528 WP_000437875.1.88561 WP_000437875.1.88830 WP_000437875.1.88880 WP_000437875.1.88891 WP_000437875.1.89322 WP_000437875.1.89405 WP_000437875.1.89492 WP_000437875.1.89569 WP_000437875.1.89959 WP_000437875.1.9009 WP_000437875.1.90139 WP_000437875.1.90219 WP_000437875.1.90257 WP_000437875.1.90342 WP_000437875.1.90703 WP_000437875.1.90837 WP_000437875.1.90848 WP_000437875.1.90897 WP_000437875.1.90967 WP_000437875.1.9098 WP_000437875.1.91072 WP_000437875.1.91088 WP_000437875.1.91288 WP_000437875.1.91356 WP_000437875.1.91651 WP_000437875.1.9168 WP_000437875.1.91685 WP_000437875.1.91801 WP_000437875.1.91871 WP_000437875.1.91894 WP_000437875.1.9199 WP_000437875.1.92558 WP_000437875.1.9264 WP_000437875.1.92750 WP_000437875.1.92819 WP_000437875.1.93027 WP_000437875.1.93069 WP_000437875.1.93253 WP_000437875.1.93427 WP_000437875.1.93428 WP_000437875.1.93630 WP_000437875.1.93745 WP_000437875.1.93800 WP_000437875.1.94213 WP_000437875.1.94367 WP_000437875.1.94544 WP_000437875.1.94676 WP_000437875.1.94686 WP_000437875.1.94790 WP_000437875.1.94806 WP_000437875.1.95011 WP_000437875.1.95035 WP_000437875.1.95129 WP_000437875.1.95244 WP_000437875.1.95661 WP_000437875.1.95834 WP_000437875.1.96222 WP_000437875.1.96229 WP_000437875.1.96425 WP_000437875.1.96479 WP_000437875.1.965 WP_000437875.1.96541 WP_000437875.1.96609 WP_000437875.1.9668 WP_000437875.1.96725 WP_000437875.1.97066 WP_000437875.1.97147 WP_000437875.1.97170 WP_000437875.1.97193 WP_000437875.1.97226 WP_000437875.1.97282 WP_000437875.1.97402 WP_000437875.1.97513 WP_000437875.1.97632 WP_000437875.1.9770 WP_000437875.1.97789 WP_000437875.1.97871 WP_000437875.1.98005 WP_000437875.1.98046 WP_000437875.1.98083 WP_000437875.1.981 WP_000437875.1.9817 WP_000437875.1.98176 WP_000437875.1.98205 WP_000437875.1.98239 WP_000437875.1.98292 WP_000437875.1.98312 WP_000437875.1.98323 WP_000437875.1.98384 WP_000437875.1.98424 WP_000437875.1.98442 WP_000437875.1.98451 WP_000437875.1.98614 WP_000437875.1.98683 WP_000437875.1.9883 WP_000437875.1.98920 WP_000437875.1.99101 WP_000437875.1.99234 WP_000437875.1.9935 WP_000437875.1.99361 WP_000437875.1.99487 WP_000437875.1.99501 WP_000437875.1.99692 WP_000437875.1.99986 YP_007151650.1.74397 YP_007151773.1.20540 YP_009147495.1.71224 gi|428783258|ref|YP_007151650.1| gi|428783383|ref|YP_007151773.1| gi|9626293|ref|NP_040629.1| 1cop_D 1cop_E 4cro_A 4cro_B 4cro_C 4cro_D 4cro_E 4cro_F 5cro_A 5cro_B 5cro_C 5cro_O gi|254791409|ref|YP_003076246.1| gi|15829529|ref|NP_308302.1| gi|387880829|ref|YP_006311131.1| gi|209397753|ref|YP_002268875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]