SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4ecp_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4ecp_A
Domain Number 1 Region: 8-163
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3e-94
Family SCOPe 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4ecp_A
Sequence length 167
Comment mol:protein length:167 Inorganic pyrophosphatase
Sequence
gpgsmvqfdvtieipkgqrnkyevdhktgrvrldrylytpmayptdygfiedtlgedgdp
ldalvllpeplfpgvlvearpvgmfrmvdehggddkvlcvpvndhrwdhihgiidvptfe
ldaikhffvhykdlepgkfvkaadwvgrdeaeaevqrsverfkaggh
Download sequence
Identical sequences cath|current|4ecpA00/0-159 cath|current|4ecpB00/0-161 4ecp_A 4ecp_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]