SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4ghj_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4ghj_B
Domain Number 1 Region: 35-92
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000926
Family SinR domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4ghj_B
Sequence length 101
Comment mol:protein length:101 Probable transcriptional regulator
Sequence
mhhhhhhssgvdlgtenlyfqsnamkhvtaaalaeeigdrlkqarlnrdltqsevaeiag
iarktvlnaekgkvqldimiailmaldlteqidlfipkqei
Download sequence
Identical sequences 4ghj_A 4ghj_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]