SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4h8i_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4h8i_B
Domain Number 1 Region: 3-252
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.81e-127
Family Phosphate binding protein-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4h8i_B
Sequence length 259
Comment mol:protein length:259 Glutamate receptor, ionotropic kainate 2
Sequence
gsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgk
ygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtp
idsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqr
vltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqe
egklhmmkekwwrgngcpe
Download sequence
Identical sequences 1s50A 1s50_A 1s7y_A 1s7y_B 1s9t_A 1s9t_B 1sd3_A 1sd3_B 1tt1_A 1tt1_B 3g3f_A 3g3f_B 4h8i_A 4h8i_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]