SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4ich_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4ich_B
Domain Number 1 Region: 192-303
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.22e-21
Family Tetracyclin repressor-like, C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 122-174
Classification Level Classification E-value
Superfamily Homeodomain-like 3.51e-20
Family Tetracyclin repressor-like, N-terminal domain 0.044
Further Details:      
 
Domain Number 3 Region: 110-281
Classification Level Classification E-value
Superfamily PDB 4.51e-16
Family PDB 0.0061
Further Details:      
 
Domain Number 4 Region: 28-97
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000758
Family Phage repressors 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4ich_B
Sequence length 311
Comment mol:protein length:311 Transcriptional regulator
Sequence
mhhhhhhssgvdlgtenlyfqsnamsesdelrrrvrglihsrpgaqrefaaaigldeskl
skslngtrrfsphelvriaehsgvtvnwlingrddartvaavpaptarsrsapagepqse
arrriletawrliarrgyhnvrihdiaselgtsnatihyhfpskkdillealrrnvklaf
drqvaelhtiadarerlvrlvelqlptpgllrdewsvwlqvwtestlnpkirdlyndayd
rwyqtiamtirtgqkqgvfrdqdadelatrlsalidglgiqvltgkrgcsvdhmrqhlnd
fiehniverrp
Download sequence
Identical sequences 4ich_A 4ich_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]