SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4jqd_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4jqd_A
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000231
Family SinR domain-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4jqd_A
Sequence length 98
Comment mol:protein length:98 Csp231I C protein
Sequence
MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMANRLAKVLKIP
VSYLYTPEDDLAQIILTWNELNEQERKRINFYIRKKAK
Download sequence
Identical sequences Q32WH4
3lfp_A 3lis_A 3lis_B 4jcx_A 4jcx_B 4jcy_A 4jcy_B 4jqd_A 4jqd_B 4jqd_E 4jqd_F cath|current|3lfpA00/1-96 cath|current|3lisA00/1-96 cath|current|3lisB00/1-96 cath|current|4jcxA00/1-94 cath|current|4jcxB00/1-95 cath|current|4jcyA00/1-92 cath|current|4jcyB00/1-92 cath|current|4jqdA00/1-94 cath|current|4jqdB00/1-94 cath|current|4jqdE00/1-97 cath|current|4jqdF00/1-93

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]