SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4mcx_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4mcx_C
Domain Number 1 Region: 8-86
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 9.63e-23
Family SinR domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4mcx_C
Sequence length 104
Comment mol:protein length:104 Antidote protein
Sequence
MRQFKVSHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSIRIAAAL
GSTPEFWLRLQSNYDLRQLENQIDTSGIVLYGESNEQQQNAQEH
Download sequence
Identical sequences A0A0U3U4F0 L7Z874 Q7A224
PvR2 4mcx_A 4mcx_C 4mcx_E gi|21233924|ref|NP_640222.1|NC_003905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]