SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4pu3_D from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4pu3_D
Domain Number 1 Region: 48-105
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000033
Family Probable transcriptional regulator VC1968, N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4pu3_D
Sequence length 118
Comment mol:protein length:118 Toxin-antitoxin system antidote transcriptional repressor Xre family
Sequence
mgsshhhhhhssglvprgshmmngtdikakvyedtlletimasplnqqslgllikerrks
aaltqdvaamlcgvtkktlirvekgedvyistvfkildglgidivsaqtsdtetngwy
Download sequence
Identical sequences 4pu3_C 4pu3_D 4pu4_C 4pu4_D 4pu7_A 4pu7_B 4pu8_A 4pu8_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]