SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4rzt_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4rzt_A
Domain Number 1 Region: 84-350
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.15e-72
Family L-arabinose binding protein-like 0.00000000216
Further Details:      
 
Domain Number 2 Region: 25-70
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.14e-24
Family GalR/LacI-like bacterial regulator 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4rzt_A
Sequence length 381
Comment mol:protein length:381 Lac repressor
Sequence
MGSSHHHHHHSSGLVPRGSHMVKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE
AAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMV
ERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLTASDQTPLNSI
IFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVDARLRLAGWHKYLTRNQIQPIAEREGD
WSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDS
SCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASP
RALADSLMQLARQVSRLESGQ
Download sequence
Identical sequences 4rzs_A 4rzs_B 4rzs_C 4rzs_D 4rzt_A 4rzt_B 4rzt_C 4rzt_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]