SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4u1o_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4u1o_A
Domain Number 1 Region: 3-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.17e-124
Family Phosphate binding protein-like 0.0000029
Further Details:      
 
Domain Number 2 Region: 119-263
Classification Level Classification E-value
Superfamily PDB 4.57e-64
Family PDB 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4u1o_A
Sequence length 263
Comment mol:protein length:263 Glutamate receptor 2
Sequence
ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlk
lseqgvldklknkwwydkgecgs
Download sequence
Identical sequences 3o28_A 4u1o_A 4u1z_A 4u22_A 4u23_A 4u2r_A 4u2r_B 4u2r_C 4u2r_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]