SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5d50_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5d50_B
Domain Number 1 Region: 105-160
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000407
Family Probable transcriptional regulator VC1968, N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5d50_B
Sequence length 199
Comment mol:protein length:199 Repressor
Sequence
AMKSIYDIRRKNLNEIILRDFDDTQLRFAERVKRSQNLVNRWCTGIKNIGPNAARIIEEA
ARKEKFWLDVDHELDAVQADIFIPATEDGEWTVEKQAAATLNAWMRKDTEMTSEKKVAVA
AGIGPATVNRIMKAEVSTTIGVLSSLARAFGHEAYEMIIPVGAPGIIDYDHRMYAALPQE
EKNKITSFINFVFEQNKSK
Download sequence
Identical sequences 5d50_A 5d50_B 5d50_C 5d50_D 5d50_I 5d50_J 5d50_K 5d50_L

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]