SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5fhm_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5fhm_B
Domain Number 1 Region: 3-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.9e-124
Family Phosphate binding protein-like 0.00000231
Further Details:      
 
Domain Number 2 Region: 119-263
Classification Level Classification E-value
Superfamily PDB 8.87e-64
Family PDB 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5fhm_B
Sequence length 264
Comment mol:protein length:264 Glutamate receptor 2,Glutamate receptor 2
Sequence
GANKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGK
YGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTP
IESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVAR
VRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLK
LNEQGLLDKLKNKWWYDKGECGSG
Download sequence
Identical sequences 4yma_A 4yma_B 5cbr_A 5cbs_A 5cbs_B 5cbs_C 5cbs_D 5fhm_A 5fhm_B 5fhn_A 5fho_A 5fho_B 5fho_C 5fho_D 5ng9_A 5nih_A 5nih_B 5oew_A 5oew_B 5oew_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]