SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5ifg_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5ifg_B
Domain Number 1 Region: 83-137
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000312
Family SinR domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5ifg_B
Sequence length 138
Comment mol:protein length:138 Antitoxin HigA
Sequence
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAW
EESAPEFAEFNAMAQAMPGGIAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLE
HAKKLATRFGISPALFID
Download sequence
Identical sequences A0A026VAV7 A0A027U0B3 A0A028ABA3 A0A028ECU7 A0A029HJ99 A0A029IKC3 A0A062Y4G7 A0A069XQR3 A0A070FCE0 A0A070T7M7 A0A070UXC8 A0A073FS28 A0A074HU40 A0A080FRA4 A0A0A8UHH8 A0A0E0U451 A0A0E0XTW3 A0A0E1M3H6 A0A0E1SRF2 A0A0E2TU42 A0A0F6MGW8 A0A0H3ELP4 A0A0M7N335 A0A127GPS2 A0A140N7L4 A0A142H6W1 A0A1E3N6L6 A0A1S6TFW1 A0A1S9JPB1 A0A1S9K4K1 A0A1W2N3D3 A0A1X3II80 A0A1X3JCK6 A0A1X3LE43 A0A222QQY6 A0A226KFB2 A0A237ET27 A7ZRW5 B3WXI7 B6I454 B7LH16 B7N085 C8UG40 D2A806 D7XRS3 D7XZ71 D8E4X0 E1IL25 E1J0Q0 E2QEC8 E3PJZ6 E6BFC6 E9TH45 E9XGJ2 F3VAD2 F3WMW0 F4NI51 F4SN83 F4T3A7 F4VJ81 F5N772 F5NZL6 G0F5T9 H4UPD5 I0VV27 I2RYS1 I2UD87 I2W8A3 I2X5P9 I6BEM6 J7R5V7 K4VGN4 K4Y7H4 L3QE00 P67701 P67702 P67703 Q0T0I6 S1D774 S1ENU5 S1H7I6 T6HAD5 T9CBX4 U9ZPT0 U9ZSQ3 V0V1K8 V6FXP5 V8FH43 W1AXC5
gi|384544680|ref|YP_005728744.1| gi|387618391|ref|YP_006121413.1| gi|218691386|ref|YP_002399598.1| gi|386635890|ref|YP_006155609.1| gi|16130977|ref|NP_417553.1| gi|30064425|ref|NP_838596.1| gi|26249671|ref|NP_755711.1| gi|170018667|ref|YP_001723621.1| gi|254163028|ref|YP_003046136.1| gi|251786357|ref|YP_003000661.1| gi|260857210|ref|YP_003231101.1| gi|386615869|ref|YP_006135535.1| NP_417553.1.90541 NP_708887.1.23235 WP_000560266.1.1000 WP_000560266.1.100044 WP_000560266.1.100052 WP_000560266.1.100085 WP_000560266.1.100111 WP_000560266.1.100151 WP_000560266.1.100185 WP_000560266.1.100220 WP_000560266.1.100251 WP_000560266.1.100306 WP_000560266.1.10034 WP_000560266.1.100346 WP_000560266.1.100425 WP_000560266.1.100441 WP_000560266.1.100487 WP_000560266.1.100496 WP_000560266.1.100499 WP_000560266.1.10051 WP_000560266.1.100531 WP_000560266.1.100543 WP_000560266.1.100667 WP_000560266.1.10067 WP_000560266.1.100685 WP_000560266.1.100689 WP_000560266.1.100718 WP_000560266.1.100758 WP_000560266.1.10080 WP_000560266.1.100803 WP_000560266.1.100824 WP_000560266.1.100836 WP_000560266.1.100867 WP_000560266.1.100868 WP_000560266.1.100959 WP_000560266.1.100966 WP_000560266.1.101033 WP_000560266.1.101102 WP_000560266.1.101157 WP_000560266.1.101158 WP_000560266.1.101186 WP_000560266.1.101216 WP_000560266.1.10126 WP_000560266.1.101282 WP_000560266.1.101359 WP_000560266.1.10138 WP_000560266.1.101418 WP_000560266.1.101423 WP_000560266.1.101429 WP_000560266.1.101436 WP_000560266.1.101468 WP_000560266.1.101518 WP_000560266.1.101522 WP_000560266.1.10154 WP_000560266.1.101545 WP_000560266.1.101630 WP_000560266.1.101653 WP_000560266.1.101654 WP_000560266.1.101667 WP_000560266.1.101668 WP_000560266.1.101686 WP_000560266.1.101693 WP_000560266.1.10173 WP_000560266.1.101737 WP_000560266.1.101747 WP_000560266.1.101777 WP_000560266.1.101786 WP_000560266.1.101840 WP_000560266.1.101845 WP_000560266.1.10187 WP_000560266.1.10188 WP_000560266.1.10190 WP_000560266.1.101900 WP_000560266.1.101908 WP_000560266.1.101913 WP_000560266.1.101947 WP_000560266.1.101952 WP_000560266.1.101969 WP_000560266.1.101984 WP_000560266.1.101987 WP_000560266.1.102036 WP_000560266.1.102069 WP_000560266.1.102076 WP_000560266.1.102106 WP_000560266.1.102122 WP_000560266.1.10226 WP_000560266.1.10235 WP_000560266.1.10252 WP_000560266.1.10304 WP_000560266.1.10361 WP_000560266.1.1040 WP_000560266.1.10417 WP_000560266.1.10461 WP_000560266.1.10491 WP_000560266.1.10496 WP_000560266.1.10524 WP_000560266.1.10538 WP_000560266.1.10579 WP_000560266.1.10607 WP_000560266.1.10673 WP_000560266.1.10763 WP_000560266.1.10786 WP_000560266.1.10798 WP_000560266.1.10824 WP_000560266.1.10833 WP_000560266.1.10869 WP_000560266.1.10988 WP_000560266.1.10989 WP_000560266.1.10994 WP_000560266.1.11032 WP_000560266.1.11047 WP_000560266.1.11052 WP_000560266.1.11068 WP_000560266.1.11113 WP_000560266.1.11118 WP_000560266.1.11121 WP_000560266.1.1113 WP_000560266.1.11133 WP_000560266.1.11241 WP_000560266.1.11285 WP_000560266.1.11399 WP_000560266.1.11411 WP_000560266.1.11436 WP_000560266.1.11437 WP_000560266.1.11519 WP_000560266.1.11575 WP_000560266.1.11616 WP_000560266.1.1168 WP_000560266.1.11699 WP_000560266.1.11759 WP_000560266.1.11801 WP_000560266.1.11803 WP_000560266.1.11912 WP_000560266.1.11949 WP_000560266.1.11955 WP_000560266.1.11981 WP_000560266.1.11982 WP_000560266.1.11985 WP_000560266.1.12036 WP_000560266.1.12050 WP_000560266.1.12051 WP_000560266.1.1212 WP_000560266.1.12157 WP_000560266.1.12268 WP_000560266.1.12295 WP_000560266.1.12320 WP_000560266.1.12344 WP_000560266.1.12415 WP_000560266.1.12458 WP_000560266.1.12542 WP_000560266.1.12558 WP_000560266.1.12574 WP_000560266.1.12582 WP_000560266.1.12645 WP_000560266.1.12675 WP_000560266.1.12697 WP_000560266.1.127 WP_000560266.1.12709 WP_000560266.1.12743 WP_000560266.1.12749 WP_000560266.1.12756 WP_000560266.1.12762 WP_000560266.1.12763 WP_000560266.1.12775 WP_000560266.1.1278 WP_000560266.1.12826 WP_000560266.1.12911 WP_000560266.1.12914 WP_000560266.1.12915 WP_000560266.1.12917 WP_000560266.1.12944 WP_000560266.1.1295 WP_000560266.1.12965 WP_000560266.1.12987 WP_000560266.1.13002 WP_000560266.1.13015 WP_000560266.1.13031 WP_000560266.1.13074 WP_000560266.1.1312 WP_000560266.1.13136 WP_000560266.1.1314 WP_000560266.1.13157 WP_000560266.1.13176 WP_000560266.1.13181 WP_000560266.1.13222 WP_000560266.1.13239 WP_000560266.1.13252 WP_000560266.1.13258 WP_000560266.1.13272 WP_000560266.1.13278 WP_000560266.1.13281 WP_000560266.1.13295 WP_000560266.1.13333 WP_000560266.1.1345 WP_000560266.1.13492 WP_000560266.1.13585 WP_000560266.1.13618 WP_000560266.1.13626 WP_000560266.1.13656 WP_000560266.1.13672 WP_000560266.1.13778 WP_000560266.1.13791 WP_000560266.1.13877 WP_000560266.1.13944 WP_000560266.1.13949 WP_000560266.1.14023 WP_000560266.1.14030 WP_000560266.1.14058 WP_000560266.1.14070 WP_000560266.1.14144 WP_000560266.1.14164 WP_000560266.1.1419 WP_000560266.1.14199 WP_000560266.1.14245 WP_000560266.1.14292 WP_000560266.1.14304 WP_000560266.1.14346 WP_000560266.1.14371 WP_000560266.1.1438 WP_000560266.1.14398 WP_000560266.1.14432 WP_000560266.1.14468 WP_000560266.1.14493 WP_000560266.1.14501 WP_000560266.1.14508 WP_000560266.1.14536 WP_000560266.1.14538 WP_000560266.1.14605 WP_000560266.1.14607 WP_000560266.1.1461 WP_000560266.1.14693 WP_000560266.1.14712 WP_000560266.1.14807 WP_000560266.1.14811 WP_000560266.1.14833 WP_000560266.1.14871 WP_000560266.1.14956 WP_000560266.1.14992 WP_000560266.1.15020 WP_000560266.1.15041 WP_000560266.1.1510 WP_000560266.1.1512 WP_000560266.1.15121 WP_000560266.1.15138 WP_000560266.1.15207 WP_000560266.1.15221 WP_000560266.1.1524 WP_000560266.1.15259 WP_000560266.1.15274 WP_000560266.1.15277 WP_000560266.1.15290 WP_000560266.1.153 WP_000560266.1.15304 WP_000560266.1.15332 WP_000560266.1.15335 WP_000560266.1.15444 WP_000560266.1.15464 WP_000560266.1.15521 WP_000560266.1.15528 WP_000560266.1.15576 WP_000560266.1.15583 WP_000560266.1.15593 WP_000560266.1.15600 WP_000560266.1.15624 WP_000560266.1.15645 WP_000560266.1.15740 WP_000560266.1.15747 WP_000560266.1.15791 WP_000560266.1.1582 WP_000560266.1.1588 WP_000560266.1.15916 WP_000560266.1.15945 WP_000560266.1.15951 WP_000560266.1.16014 WP_000560266.1.16086 WP_000560266.1.1609 WP_000560266.1.16102 WP_000560266.1.16111 WP_000560266.1.16131 WP_000560266.1.16154 WP_000560266.1.16171 WP_000560266.1.16179 WP_000560266.1.16183 WP_000560266.1.1622 WP_000560266.1.16270 WP_000560266.1.16294 WP_000560266.1.1634 WP_000560266.1.16387 WP_000560266.1.16388 WP_000560266.1.1640 WP_000560266.1.16517 WP_000560266.1.16532 WP_000560266.1.16541 WP_000560266.1.16577 WP_000560266.1.16608 WP_000560266.1.16682 WP_000560266.1.16705 WP_000560266.1.16715 WP_000560266.1.16721 WP_000560266.1.16745 WP_000560266.1.16752 WP_000560266.1.16798 WP_000560266.1.16799 WP_000560266.1.16861 WP_000560266.1.16927 WP_000560266.1.16992 WP_000560266.1.17018 WP_000560266.1.17028 WP_000560266.1.17084 WP_000560266.1.17087 WP_000560266.1.17102 WP_000560266.1.17114 WP_000560266.1.17119 WP_000560266.1.17153 WP_000560266.1.17170 WP_000560266.1.17172 WP_000560266.1.17182 WP_000560266.1.17241 WP_000560266.1.17282 WP_000560266.1.17290 WP_000560266.1.17325 WP_000560266.1.17360 WP_000560266.1.17387 WP_000560266.1.17403 WP_000560266.1.17432 WP_000560266.1.17461 WP_000560266.1.17464 WP_000560266.1.17534 WP_000560266.1.1754 WP_000560266.1.1755 WP_000560266.1.17550 WP_000560266.1.17577 WP_000560266.1.17595 WP_000560266.1.17623 WP_000560266.1.1763 WP_000560266.1.17637 WP_000560266.1.17680 WP_000560266.1.17711 WP_000560266.1.17766 WP_000560266.1.17849 WP_000560266.1.17889 WP_000560266.1.17920 WP_000560266.1.17952 WP_000560266.1.17963 WP_000560266.1.18000 WP_000560266.1.18006 WP_000560266.1.18064 WP_000560266.1.18121 WP_000560266.1.18133 WP_000560266.1.18134 WP_000560266.1.18141 WP_000560266.1.18164 WP_000560266.1.1821 WP_000560266.1.18226 WP_000560266.1.18275 WP_000560266.1.18316 WP_000560266.1.18381 WP_000560266.1.18402 WP_000560266.1.18410 WP_000560266.1.18436 WP_000560266.1.18438 WP_000560266.1.18458 WP_000560266.1.18482 WP_000560266.1.18519 WP_000560266.1.18530 WP_000560266.1.18550 WP_000560266.1.18581 WP_000560266.1.18588 WP_000560266.1.18650 WP_000560266.1.1866 WP_000560266.1.18666 WP_000560266.1.1867 WP_000560266.1.18714 WP_000560266.1.18734 WP_000560266.1.18802 WP_000560266.1.18828 WP_000560266.1.18858 WP_000560266.1.18861 WP_000560266.1.18899 WP_000560266.1.18908 WP_000560266.1.18934 WP_000560266.1.1896 WP_000560266.1.18962 WP_000560266.1.18983 WP_000560266.1.19024 WP_000560266.1.19036 WP_000560266.1.1906 WP_000560266.1.19075 WP_000560266.1.19100 WP_000560266.1.19114 WP_000560266.1.19135 WP_000560266.1.19147 WP_000560266.1.19148 WP_000560266.1.19150 WP_000560266.1.19171 WP_000560266.1.19194 WP_000560266.1.19205 WP_000560266.1.19277 WP_000560266.1.193 WP_000560266.1.19313 WP_000560266.1.19332 WP_000560266.1.19361 WP_000560266.1.19424 WP_000560266.1.19453 WP_000560266.1.19478 WP_000560266.1.19492 WP_000560266.1.19494 WP_000560266.1.19534 WP_000560266.1.19544 WP_000560266.1.19581 WP_000560266.1.19583 WP_000560266.1.1960 WP_000560266.1.19654 WP_000560266.1.19684 WP_000560266.1.19691 WP_000560266.1.19760 WP_000560266.1.19761 WP_000560266.1.19778 WP_000560266.1.19795 WP_000560266.1.1982 WP_000560266.1.19889 WP_000560266.1.19940 WP_000560266.1.19957 WP_000560266.1.19972 WP_000560266.1.19994 WP_000560266.1.20114 WP_000560266.1.20115 WP_000560266.1.20129 WP_000560266.1.20136 WP_000560266.1.20151 WP_000560266.1.20159 WP_000560266.1.20164 WP_000560266.1.20170 WP_000560266.1.20289 WP_000560266.1.20308 WP_000560266.1.20331 WP_000560266.1.20334 WP_000560266.1.20388 WP_000560266.1.20445 WP_000560266.1.20452 WP_000560266.1.20483 WP_000560266.1.20484 WP_000560266.1.20506 WP_000560266.1.20536 WP_000560266.1.20549 WP_000560266.1.20565 WP_000560266.1.20596 WP_000560266.1.2063 WP_000560266.1.20630 WP_000560266.1.20638 WP_000560266.1.20730 WP_000560266.1.20737 WP_000560266.1.20784 WP_000560266.1.20803 WP_000560266.1.20818 WP_000560266.1.20863 WP_000560266.1.2092 WP_000560266.1.20933 WP_000560266.1.20943 WP_000560266.1.20958 WP_000560266.1.20962 WP_000560266.1.20982 WP_000560266.1.2100 WP_000560266.1.21020 WP_000560266.1.21029 WP_000560266.1.21033 WP_000560266.1.21041 WP_000560266.1.21057 WP_000560266.1.21122 WP_000560266.1.21137 WP_000560266.1.21248 WP_000560266.1.21251 WP_000560266.1.21255 WP_000560266.1.21336 WP_000560266.1.2142 WP_000560266.1.21470 WP_000560266.1.21526 WP_000560266.1.2156 WP_000560266.1.21573 WP_000560266.1.21614 WP_000560266.1.21628 WP_000560266.1.21656 WP_000560266.1.21661 WP_000560266.1.21667 WP_000560266.1.21729 WP_000560266.1.21732 WP_000560266.1.21733 WP_000560266.1.21758 WP_000560266.1.21771 WP_000560266.1.21823 WP_000560266.1.21899 WP_000560266.1.21915 WP_000560266.1.21945 WP_000560266.1.2198 WP_000560266.1.22021 WP_000560266.1.22042 WP_000560266.1.22060 WP_000560266.1.22088 WP_000560266.1.22098 WP_000560266.1.22113 WP_000560266.1.22182 WP_000560266.1.22195 WP_000560266.1.22269 WP_000560266.1.22291 WP_000560266.1.22293 WP_000560266.1.22328 WP_000560266.1.22359 WP_000560266.1.22363 WP_000560266.1.22409 WP_000560266.1.22450 WP_000560266.1.22494 WP_000560266.1.22508 WP_000560266.1.22522 WP_000560266.1.22544 WP_000560266.1.22572 WP_000560266.1.22574 WP_000560266.1.22579 WP_000560266.1.22631 WP_000560266.1.22632 WP_000560266.1.22649 WP_000560266.1.22662 WP_000560266.1.22667 WP_000560266.1.22669 WP_000560266.1.22771 WP_000560266.1.22830 WP_000560266.1.22868 WP_000560266.1.22875 WP_000560266.1.22885 WP_000560266.1.22896 WP_000560266.1.22908 WP_000560266.1.2300 WP_000560266.1.23005 WP_000560266.1.23044 WP_000560266.1.23078 WP_000560266.1.23090 WP_000560266.1.23092 WP_000560266.1.23105 WP_000560266.1.2322 WP_000560266.1.23282 WP_000560266.1.23285 WP_000560266.1.23376 WP_000560266.1.23378 WP_000560266.1.23386 WP_000560266.1.23388 WP_000560266.1.23393 WP_000560266.1.23463 WP_000560266.1.23486 WP_000560266.1.23511 WP_000560266.1.23520 WP_000560266.1.23549 WP_000560266.1.23593 WP_000560266.1.2362 WP_000560266.1.23622 WP_000560266.1.23676 WP_000560266.1.23686 WP_000560266.1.23693 WP_000560266.1.23700 WP_000560266.1.23711 WP_000560266.1.23741 WP_000560266.1.23754 WP_000560266.1.23765 WP_000560266.1.23804 WP_000560266.1.23812 WP_000560266.1.23855 WP_000560266.1.23898 WP_000560266.1.23945 WP_000560266.1.2395 WP_000560266.1.23970 WP_000560266.1.24024 WP_000560266.1.24038 WP_000560266.1.24089 WP_000560266.1.24122 WP_000560266.1.24124 WP_000560266.1.24177 WP_000560266.1.2418 WP_000560266.1.24233 WP_000560266.1.2428 WP_000560266.1.2430 WP_000560266.1.24304 WP_000560266.1.24316 WP_000560266.1.2433 WP_000560266.1.24362 WP_000560266.1.24383 WP_000560266.1.24460 WP_000560266.1.24473 WP_000560266.1.24483 WP_000560266.1.24523 WP_000560266.1.24575 WP_000560266.1.24583 WP_000560266.1.24616 WP_000560266.1.24641 WP_000560266.1.24646 WP_000560266.1.24693 WP_000560266.1.24695 WP_000560266.1.24797 WP_000560266.1.24808 WP_000560266.1.24899 WP_000560266.1.24968 WP_000560266.1.25019 WP_000560266.1.2502 WP_000560266.1.25038 WP_000560266.1.25050 WP_000560266.1.25085 WP_000560266.1.25086 WP_000560266.1.2512 WP_000560266.1.25141 WP_000560266.1.25183 WP_000560266.1.25203 WP_000560266.1.25248 WP_000560266.1.25312 WP_000560266.1.25324 WP_000560266.1.25378 WP_000560266.1.2543 WP_000560266.1.2558 WP_000560266.1.25592 WP_000560266.1.25612 WP_000560266.1.25613 WP_000560266.1.25631 WP_000560266.1.25643 WP_000560266.1.25680 WP_000560266.1.25713 WP_000560266.1.25726 WP_000560266.1.25750 WP_000560266.1.25755 WP_000560266.1.25799 WP_000560266.1.25832 WP_000560266.1.25843 WP_000560266.1.2588 WP_000560266.1.25886 WP_000560266.1.25996 WP_000560266.1.26005 WP_000560266.1.26048 WP_000560266.1.26130 WP_000560266.1.26175 WP_000560266.1.26186 WP_000560266.1.26270 WP_000560266.1.26284 WP_000560266.1.26331 WP_000560266.1.2637 WP_000560266.1.26379 WP_000560266.1.26398 WP_000560266.1.2642 WP_000560266.1.26443 WP_000560266.1.26479 WP_000560266.1.26480 WP_000560266.1.26579 WP_000560266.1.26598 WP_000560266.1.26609 WP_000560266.1.26613 WP_000560266.1.26658 WP_000560266.1.26683 WP_000560266.1.26720 WP_000560266.1.26736 WP_000560266.1.26837 WP_000560266.1.26861 WP_000560266.1.26912 WP_000560266.1.26932 WP_000560266.1.26943 WP_000560266.1.2700 WP_000560266.1.27019 WP_000560266.1.27057 WP_000560266.1.27060 WP_000560266.1.27098 WP_000560266.1.27134 WP_000560266.1.27148 WP_000560266.1.27175 WP_000560266.1.27214 WP_000560266.1.27283 WP_000560266.1.2731 WP_000560266.1.27310 WP_000560266.1.27313 WP_000560266.1.27330 WP_000560266.1.27424 WP_000560266.1.2745 WP_000560266.1.27451 WP_000560266.1.27472 WP_000560266.1.27504 WP_000560266.1.27520 WP_000560266.1.27560 WP_000560266.1.27580 WP_000560266.1.27585 WP_000560266.1.27611 WP_000560266.1.27742 WP_000560266.1.27774 WP_000560266.1.27856 WP_000560266.1.27861 WP_000560266.1.27871 WP_000560266.1.27879 WP_000560266.1.27897 WP_000560266.1.27923 WP_000560266.1.27957 WP_000560266.1.27971 WP_000560266.1.28027 WP_000560266.1.2811 WP_000560266.1.28128 WP_000560266.1.28167 WP_000560266.1.28199 WP_000560266.1.2823 WP_000560266.1.28250 WP_000560266.1.28268 WP_000560266.1.28271 WP_000560266.1.28305 WP_000560266.1.28345 WP_000560266.1.28371 WP_000560266.1.2838 WP_000560266.1.28480 WP_000560266.1.28491 WP_000560266.1.28500 WP_000560266.1.28509 WP_000560266.1.28568 WP_000560266.1.28662 WP_000560266.1.28683 WP_000560266.1.28697 WP_000560266.1.28711 WP_000560266.1.28723 WP_000560266.1.28732 WP_000560266.1.28736 WP_000560266.1.28809 WP_000560266.1.2881 WP_000560266.1.28919 WP_000560266.1.28924 WP_000560266.1.28994 WP_000560266.1.29013 WP_000560266.1.29016 WP_000560266.1.29055 WP_000560266.1.29061 WP_000560266.1.29082 WP_000560266.1.29118 WP_000560266.1.29128 WP_000560266.1.29150 WP_000560266.1.29202 WP_000560266.1.29206 WP_000560266.1.29221 WP_000560266.1.29239 WP_000560266.1.29258 WP_000560266.1.2926 WP_000560266.1.2931 WP_000560266.1.29429 WP_000560266.1.2945 WP_000560266.1.29503 WP_000560266.1.29504 WP_000560266.1.2952 WP_000560266.1.29523 WP_000560266.1.2963 WP_000560266.1.29647 WP_000560266.1.29662 WP_000560266.1.29669 WP_000560266.1.29689 WP_000560266.1.29715 WP_000560266.1.29724 WP_000560266.1.29746 WP_000560266.1.29798 WP_000560266.1.29812 WP_000560266.1.29819 WP_000560266.1.29855 WP_000560266.1.29876 WP_000560266.1.29979 WP_000560266.1.29992 WP_000560266.1.30035 WP_000560266.1.30123 WP_000560266.1.30231 WP_000560266.1.30232 WP_000560266.1.30247 WP_000560266.1.30253 WP_000560266.1.30298 WP_000560266.1.30399 WP_000560266.1.30400 WP_000560266.1.30428 WP_000560266.1.30447 WP_000560266.1.3045 WP_000560266.1.30472 WP_000560266.1.30479 WP_000560266.1.30497 WP_000560266.1.30524 WP_000560266.1.30546 WP_000560266.1.3055 WP_000560266.1.30554 WP_000560266.1.30630 WP_000560266.1.30639 WP_000560266.1.30640 WP_000560266.1.30658 WP_000560266.1.30742 WP_000560266.1.30749 WP_000560266.1.30843 WP_000560266.1.30853 WP_000560266.1.30866 WP_000560266.1.30887 WP_000560266.1.309 WP_000560266.1.31009 WP_000560266.1.31119 WP_000560266.1.31129 WP_000560266.1.31142 WP_000560266.1.31211 WP_000560266.1.31295 WP_000560266.1.31319 WP_000560266.1.31340 WP_000560266.1.31347 WP_000560266.1.31357 WP_000560266.1.31379 WP_000560266.1.31407 WP_000560266.1.31419 WP_000560266.1.31429 WP_000560266.1.31431 WP_000560266.1.31506 WP_000560266.1.31518 WP_000560266.1.31614 WP_000560266.1.31657 WP_000560266.1.31675 WP_000560266.1.31681 WP_000560266.1.31709 WP_000560266.1.3176 WP_000560266.1.31803 WP_000560266.1.3181 WP_000560266.1.31825 WP_000560266.1.31833 WP_000560266.1.31835 WP_000560266.1.31839 WP_000560266.1.31866 WP_000560266.1.31924 WP_000560266.1.3193 WP_000560266.1.31978 WP_000560266.1.32024 WP_000560266.1.32037 WP_000560266.1.32091 WP_000560266.1.32093 WP_000560266.1.3212 WP_000560266.1.32121 WP_000560266.1.32127 WP_000560266.1.32138 WP_000560266.1.32142 WP_000560266.1.32143 WP_000560266.1.3215 WP_000560266.1.32225 WP_000560266.1.32234 WP_000560266.1.32236 WP_000560266.1.32287 WP_000560266.1.3233 WP_000560266.1.32394 WP_000560266.1.3247 WP_000560266.1.32475 WP_000560266.1.32478 WP_000560266.1.32479 WP_000560266.1.3248 WP_000560266.1.32509 WP_000560266.1.32518 WP_000560266.1.32561 WP_000560266.1.32591 WP_000560266.1.32601 WP_000560266.1.32650 WP_000560266.1.32661 WP_000560266.1.32722 WP_000560266.1.32724 WP_000560266.1.32748 WP_000560266.1.32831 WP_000560266.1.32875 WP_000560266.1.32903 WP_000560266.1.32946 WP_000560266.1.32972 WP_000560266.1.32984 WP_000560266.1.32995 WP_000560266.1.33014 WP_000560266.1.33018 WP_000560266.1.33022 WP_000560266.1.33046 WP_000560266.1.33179 WP_000560266.1.33190 WP_000560266.1.33238 WP_000560266.1.33244 WP_000560266.1.33325 WP_000560266.1.33341 WP_000560266.1.334 WP_000560266.1.33408 WP_000560266.1.33422 WP_000560266.1.33424 WP_000560266.1.33502 WP_000560266.1.33526 WP_000560266.1.3354 WP_000560266.1.33545 WP_000560266.1.33565 WP_000560266.1.33595 WP_000560266.1.33648 WP_000560266.1.33680 WP_000560266.1.33736 WP_000560266.1.33745 WP_000560266.1.33746 WP_000560266.1.33799 WP_000560266.1.33854 WP_000560266.1.33879 WP_000560266.1.33888 WP_000560266.1.33896 WP_000560266.1.33914 WP_000560266.1.33952 WP_000560266.1.33973 WP_000560266.1.3398 WP_000560266.1.3401 WP_000560266.1.34032 WP_000560266.1.34094 WP_000560266.1.34122 WP_000560266.1.34124 WP_000560266.1.34130 WP_000560266.1.34208 WP_000560266.1.34270 WP_000560266.1.34277 WP_000560266.1.34294 WP_000560266.1.34332 WP_000560266.1.34362 WP_000560266.1.34363 WP_000560266.1.34422 WP_000560266.1.34441 WP_000560266.1.34456 WP_000560266.1.34525 WP_000560266.1.34532 WP_000560266.1.34538 WP_000560266.1.34605 WP_000560266.1.34683 WP_000560266.1.3469 WP_000560266.1.34727 WP_000560266.1.34763 WP_000560266.1.34781 WP_000560266.1.34838 WP_000560266.1.34990 WP_000560266.1.34993 WP_000560266.1.35107 WP_000560266.1.35114 WP_000560266.1.35127 WP_000560266.1.35195 WP_000560266.1.35202 WP_000560266.1.35204 WP_000560266.1.35208 WP_000560266.1.35211 WP_000560266.1.35253 WP_000560266.1.35316 WP_000560266.1.35328 WP_000560266.1.35360 WP_000560266.1.35365 WP_000560266.1.35368 WP_000560266.1.3539 WP_000560266.1.35394 WP_000560266.1.35465 WP_000560266.1.35578 WP_000560266.1.35604 WP_000560266.1.35649 WP_000560266.1.35698 WP_000560266.1.35704 WP_000560266.1.35724 WP_000560266.1.35740 WP_000560266.1.35741 WP_000560266.1.35789 WP_000560266.1.35889 WP_000560266.1.35904 WP_000560266.1.35922 WP_000560266.1.35927 WP_000560266.1.3600 WP_000560266.1.36042 WP_000560266.1.36129 WP_000560266.1.36164 WP_000560266.1.36166 WP_000560266.1.36177 WP_000560266.1.36207 WP_000560266.1.36334 WP_000560266.1.36386 WP_000560266.1.36393 WP_000560266.1.36412 WP_000560266.1.36459 WP_000560266.1.36496 WP_000560266.1.36507 WP_000560266.1.36627 WP_000560266.1.36707 WP_000560266.1.36739 WP_000560266.1.36746 WP_000560266.1.36747 WP_000560266.1.36812 WP_000560266.1.36833 WP_000560266.1.36925 WP_000560266.1.36975 WP_000560266.1.37020 WP_000560266.1.37032 WP_000560266.1.37046 WP_000560266.1.37103 WP_000560266.1.37122 WP_000560266.1.37155 WP_000560266.1.3723 WP_000560266.1.37233 WP_000560266.1.37261 WP_000560266.1.37266 WP_000560266.1.37352 WP_000560266.1.37371 WP_000560266.1.37388 WP_000560266.1.37433 WP_000560266.1.37445 WP_000560266.1.37477 WP_000560266.1.37485 WP_000560266.1.37510 WP_000560266.1.37538 WP_000560266.1.37548 WP_000560266.1.37549 WP_000560266.1.37554 WP_000560266.1.37576 WP_000560266.1.37588 WP_000560266.1.37608 WP_000560266.1.37637 WP_000560266.1.377 WP_000560266.1.3772 WP_000560266.1.37730 WP_000560266.1.37750 WP_000560266.1.37758 WP_000560266.1.37830 WP_000560266.1.37847 WP_000560266.1.37852 WP_000560266.1.37853 WP_000560266.1.3788 WP_000560266.1.37880 WP_000560266.1.37897 WP_000560266.1.37917 WP_000560266.1.37926 WP_000560266.1.37962 WP_000560266.1.37964 WP_000560266.1.37995 WP_000560266.1.38033 WP_000560266.1.38080 WP_000560266.1.38081 WP_000560266.1.38103 WP_000560266.1.38105 WP_000560266.1.3811 WP_000560266.1.38119 WP_000560266.1.3815 WP_000560266.1.38182 WP_000560266.1.38202 WP_000560266.1.38211 WP_000560266.1.38323 WP_000560266.1.38357 WP_000560266.1.38363 WP_000560266.1.38371 WP_000560266.1.38412 WP_000560266.1.38485 WP_000560266.1.38584 WP_000560266.1.38626 WP_000560266.1.38636 WP_000560266.1.3873 WP_000560266.1.38777 WP_000560266.1.38811 WP_000560266.1.38920 WP_000560266.1.38935 WP_000560266.1.38950 WP_000560266.1.39005 WP_000560266.1.39037 WP_000560266.1.39042 WP_000560266.1.39063 WP_000560266.1.39103 WP_000560266.1.3912 WP_000560266.1.39123 WP_000560266.1.39150 WP_000560266.1.39164 WP_000560266.1.39167 WP_000560266.1.39209 WP_000560266.1.39286 WP_000560266.1.39302 WP_000560266.1.39313 WP_000560266.1.39356 WP_000560266.1.39358 WP_000560266.1.39365 WP_000560266.1.39367 WP_000560266.1.39423 WP_000560266.1.39430 WP_000560266.1.39509 WP_000560266.1.3954 WP_000560266.1.39594 WP_000560266.1.39606 WP_000560266.1.39607 WP_000560266.1.39636 WP_000560266.1.39651 WP_000560266.1.39690 WP_000560266.1.3970 WP_000560266.1.39709 WP_000560266.1.39717 WP_000560266.1.39726 WP_000560266.1.39734 WP_000560266.1.3980 WP_000560266.1.39829 WP_000560266.1.39870 WP_000560266.1.39938 WP_000560266.1.39961 WP_000560266.1.39966 WP_000560266.1.39970 WP_000560266.1.39998 WP_000560266.1.40016 WP_000560266.1.40019 WP_000560266.1.40083 WP_000560266.1.40088 WP_000560266.1.40140 WP_000560266.1.40153 WP_000560266.1.40192 WP_000560266.1.4020 WP_000560266.1.40206 WP_000560266.1.40212 WP_000560266.1.40218 WP_000560266.1.40238 WP_000560266.1.40249 WP_000560266.1.40315 WP_000560266.1.40317 WP_000560266.1.40335 WP_000560266.1.40349 WP_000560266.1.40382 WP_000560266.1.40389 WP_000560266.1.40445 WP_000560266.1.40486 WP_000560266.1.40499 WP_000560266.1.40524 WP_000560266.1.40539 WP_000560266.1.40548 WP_000560266.1.40596 WP_000560266.1.406 WP_000560266.1.40686 WP_000560266.1.40712 WP_000560266.1.40815 WP_000560266.1.40833 WP_000560266.1.40843 WP_000560266.1.40898 WP_000560266.1.40912 WP_000560266.1.40937 WP_000560266.1.40965 WP_000560266.1.41041 WP_000560266.1.41063 WP_000560266.1.41078 WP_000560266.1.41125 WP_000560266.1.41206 WP_000560266.1.4122 WP_000560266.1.41239 WP_000560266.1.4126 WP_000560266.1.41332 WP_000560266.1.41339 WP_000560266.1.41363 WP_000560266.1.41371 WP_000560266.1.41372 WP_000560266.1.41391 WP_000560266.1.41392 WP_000560266.1.41402 WP_000560266.1.41407 WP_000560266.1.41417 WP_000560266.1.41436 WP_000560266.1.41449 WP_000560266.1.41455 WP_000560266.1.41466 WP_000560266.1.41479 WP_000560266.1.41484 WP_000560266.1.41488 WP_000560266.1.41513 WP_000560266.1.41530 WP_000560266.1.41539 WP_000560266.1.41556 WP_000560266.1.41613 WP_000560266.1.41651 WP_000560266.1.41654 WP_000560266.1.41741 WP_000560266.1.41752 WP_000560266.1.41780 WP_000560266.1.41782 WP_000560266.1.41783 WP_000560266.1.41784 WP_000560266.1.41813 WP_000560266.1.41826 WP_000560266.1.41884 WP_000560266.1.41885 WP_000560266.1.41900 WP_000560266.1.41960 WP_000560266.1.41964 WP_000560266.1.41988 WP_000560266.1.42022 WP_000560266.1.42027 WP_000560266.1.42038 WP_000560266.1.42073 WP_000560266.1.42113 WP_000560266.1.42138 WP_000560266.1.4214 WP_000560266.1.42179 WP_000560266.1.42203 WP_000560266.1.42209 WP_000560266.1.42214 WP_000560266.1.42233 WP_000560266.1.4224 WP_000560266.1.42252 WP_000560266.1.42318 WP_000560266.1.42376 WP_000560266.1.42387 WP_000560266.1.42415 WP_000560266.1.4242 WP_000560266.1.42442 WP_000560266.1.42448 WP_000560266.1.42456 WP_000560266.1.42516 WP_000560266.1.42547 WP_000560266.1.42600 WP_000560266.1.42669 WP_000560266.1.42677 WP_000560266.1.42748 WP_000560266.1.42770 WP_000560266.1.42771 WP_000560266.1.4282 WP_000560266.1.42832 WP_000560266.1.42879 WP_000560266.1.42918 WP_000560266.1.42936 WP_000560266.1.42991 WP_000560266.1.43035 WP_000560266.1.4306 WP_000560266.1.43133 WP_000560266.1.43137 WP_000560266.1.43166 WP_000560266.1.43170 WP_000560266.1.43177 WP_000560266.1.43239 WP_000560266.1.43270 WP_000560266.1.43316 WP_000560266.1.43389 WP_000560266.1.4342 WP_000560266.1.43427 WP_000560266.1.43444 WP_000560266.1.43455 WP_000560266.1.43473 WP_000560266.1.43489 WP_000560266.1.43561 WP_000560266.1.43804 WP_000560266.1.43868 WP_000560266.1.43898 WP_000560266.1.43918 WP_000560266.1.43942 WP_000560266.1.43989 WP_000560266.1.44018 WP_000560266.1.44029 WP_000560266.1.44040 WP_000560266.1.44051 WP_000560266.1.44077 WP_000560266.1.44088 WP_000560266.1.44096 WP_000560266.1.44100 WP_000560266.1.44115 WP_000560266.1.4415 WP_000560266.1.44162 WP_000560266.1.44166 WP_000560266.1.44222 WP_000560266.1.44238 WP_000560266.1.44273 WP_000560266.1.44285 WP_000560266.1.44324 WP_000560266.1.44327 WP_000560266.1.44354 WP_000560266.1.44365 WP_000560266.1.44445 WP_000560266.1.44447 WP_000560266.1.44458 WP_000560266.1.4449 WP_000560266.1.44524 WP_000560266.1.44558 WP_000560266.1.44570 WP_000560266.1.4459 WP_000560266.1.44627 WP_000560266.1.44661 WP_000560266.1.44671 WP_000560266.1.44717 WP_000560266.1.44724 WP_000560266.1.4473 WP_000560266.1.44800 WP_000560266.1.44821 WP_000560266.1.44841 WP_000560266.1.44849 WP_000560266.1.44854 WP_000560266.1.44855 WP_000560266.1.44857 WP_000560266.1.44923 WP_000560266.1.44960 WP_000560266.1.44970 WP_000560266.1.44977 WP_000560266.1.44980 WP_000560266.1.45000 WP_000560266.1.45025 WP_000560266.1.45028 WP_000560266.1.45053 WP_000560266.1.45116 WP_000560266.1.4516 WP_000560266.1.45190 WP_000560266.1.45208 WP_000560266.1.45246 WP_000560266.1.4530 WP_000560266.1.45329 WP_000560266.1.4535 WP_000560266.1.45392 WP_000560266.1.45440 WP_000560266.1.4549 WP_000560266.1.45525 WP_000560266.1.45536 WP_000560266.1.45565 WP_000560266.1.45581 WP_000560266.1.45595 WP_000560266.1.4570 WP_000560266.1.4574 WP_000560266.1.45741 WP_000560266.1.4576 WP_000560266.1.45789 WP_000560266.1.45799 WP_000560266.1.45801 WP_000560266.1.45846 WP_000560266.1.45868 WP_000560266.1.45891 WP_000560266.1.4593 WP_000560266.1.45933 WP_000560266.1.45945 WP_000560266.1.45960 WP_000560266.1.4600 WP_000560266.1.46016 WP_000560266.1.46026 WP_000560266.1.46097 WP_000560266.1.4610 WP_000560266.1.46105 WP_000560266.1.46115 WP_000560266.1.46186 WP_000560266.1.46213 WP_000560266.1.46217 WP_000560266.1.46239 WP_000560266.1.46257 WP_000560266.1.46325 WP_000560266.1.46378 WP_000560266.1.46429 WP_000560266.1.46433 WP_000560266.1.46438 WP_000560266.1.46441 WP_000560266.1.4646 WP_000560266.1.46487 WP_000560266.1.46526 WP_000560266.1.46552 WP_000560266.1.46555 WP_000560266.1.4657 WP_000560266.1.46573 WP_000560266.1.46582 WP_000560266.1.46589 WP_000560266.1.46616 WP_000560266.1.46643 WP_000560266.1.46668 WP_000560266.1.4670 WP_000560266.1.46795 WP_000560266.1.46802 WP_000560266.1.46820 WP_000560266.1.46821 WP_000560266.1.46909 WP_000560266.1.46932 WP_000560266.1.4695 WP_000560266.1.46990 WP_000560266.1.46999 WP_000560266.1.47024 WP_000560266.1.47028 WP_000560266.1.47029 WP_000560266.1.47034 WP_000560266.1.47038 WP_000560266.1.47047 WP_000560266.1.47048 WP_000560266.1.47050 WP_000560266.1.47054 WP_000560266.1.47069 WP_000560266.1.47156 WP_000560266.1.47171 WP_000560266.1.47186 WP_000560266.1.47189 WP_000560266.1.47224 WP_000560266.1.47235 WP_000560266.1.47349 WP_000560266.1.47356 WP_000560266.1.47363 WP_000560266.1.47366 WP_000560266.1.47386 WP_000560266.1.4740 WP_000560266.1.47401 WP_000560266.1.47414 WP_000560266.1.47425 WP_000560266.1.47454 WP_000560266.1.47464 WP_000560266.1.47473 WP_000560266.1.47488 WP_000560266.1.47496 WP_000560266.1.47498 WP_000560266.1.47634 WP_000560266.1.47646 WP_000560266.1.47662 WP_000560266.1.47673 WP_000560266.1.47709 WP_000560266.1.4772 WP_000560266.1.47734 WP_000560266.1.47740 WP_000560266.1.47744 WP_000560266.1.47764 WP_000560266.1.47765 WP_000560266.1.47770 WP_000560266.1.47775 WP_000560266.1.47790 WP_000560266.1.47791 WP_000560266.1.47820 WP_000560266.1.47848 WP_000560266.1.4796 WP_000560266.1.48000 WP_000560266.1.48018 WP_000560266.1.48048 WP_000560266.1.48077 WP_000560266.1.48080 WP_000560266.1.48096 WP_000560266.1.48111 WP_000560266.1.48144 WP_000560266.1.48188 WP_000560266.1.48194 WP_000560266.1.48200 WP_000560266.1.48203 WP_000560266.1.48222 WP_000560266.1.48265 WP_000560266.1.48290 WP_000560266.1.48291 WP_000560266.1.48353 WP_000560266.1.48371 WP_000560266.1.48385 WP_000560266.1.48421 WP_000560266.1.48431 WP_000560266.1.48433 WP_000560266.1.48480 WP_000560266.1.48483 WP_000560266.1.48505 WP_000560266.1.48522 WP_000560266.1.4857 WP_000560266.1.48571 WP_000560266.1.486 WP_000560266.1.48626 WP_000560266.1.48678 WP_000560266.1.4871 WP_000560266.1.48801 WP_000560266.1.48808 WP_000560266.1.48847 WP_000560266.1.48860 WP_000560266.1.48902 WP_000560266.1.48910 WP_000560266.1.4892 WP_000560266.1.48953 WP_000560266.1.48954 WP_000560266.1.48974 WP_000560266.1.49009 WP_000560266.1.49076 WP_000560266.1.49107 WP_000560266.1.49124 WP_000560266.1.49147 WP_000560266.1.49170 WP_000560266.1.49179 WP_000560266.1.49229 WP_000560266.1.49243 WP_000560266.1.49312 WP_000560266.1.49336 WP_000560266.1.49338 WP_000560266.1.49342 WP_000560266.1.49412 WP_000560266.1.49482 WP_000560266.1.49483 WP_000560266.1.4953 WP_000560266.1.49531 WP_000560266.1.49537 WP_000560266.1.49645 WP_000560266.1.49661 WP_000560266.1.497 WP_000560266.1.49712 WP_000560266.1.49733 WP_000560266.1.49740 WP_000560266.1.49768 WP_000560266.1.49774 WP_000560266.1.49823 WP_000560266.1.49856 WP_000560266.1.49861 WP_000560266.1.49883 WP_000560266.1.49900 WP_000560266.1.49941 WP_000560266.1.49950 WP_000560266.1.49954 WP_000560266.1.50006 WP_000560266.1.50008 WP_000560266.1.50056 WP_000560266.1.50078 WP_000560266.1.50113 WP_000560266.1.50119 WP_000560266.1.5017 WP_000560266.1.50179 WP_000560266.1.50182 WP_000560266.1.50214 WP_000560266.1.50228 WP_000560266.1.50258 WP_000560266.1.50270 WP_000560266.1.50278 WP_000560266.1.50418 WP_000560266.1.50427 WP_000560266.1.5056 WP_000560266.1.50564 WP_000560266.1.50579 WP_000560266.1.50586 WP_000560266.1.50608 WP_000560266.1.50616 WP_000560266.1.50627 WP_000560266.1.50725 WP_000560266.1.50925 WP_000560266.1.50957 WP_000560266.1.50969 WP_000560266.1.51013 WP_000560266.1.51042 WP_000560266.1.51058 WP_000560266.1.5106 WP_000560266.1.511 WP_000560266.1.51109 WP_000560266.1.51172 WP_000560266.1.51175 WP_000560266.1.51206 WP_000560266.1.51248 WP_000560266.1.51255 WP_000560266.1.51260 WP_000560266.1.51278 WP_000560266.1.51299 WP_000560266.1.51300 WP_000560266.1.51325 WP_000560266.1.51330 WP_000560266.1.51380 WP_000560266.1.51425 WP_000560266.1.51426 WP_000560266.1.51430 WP_000560266.1.51441 WP_000560266.1.5146 WP_000560266.1.51495 WP_000560266.1.51525 WP_000560266.1.5153 WP_000560266.1.51537 WP_000560266.1.51539 WP_000560266.1.51548 WP_000560266.1.51552 WP_000560266.1.51580 WP_000560266.1.51587 WP_000560266.1.51600 WP_000560266.1.51607 WP_000560266.1.51629 WP_000560266.1.51718 WP_000560266.1.51736 WP_000560266.1.51784 WP_000560266.1.51804 WP_000560266.1.51837 WP_000560266.1.51968 WP_000560266.1.52002 WP_000560266.1.52020 WP_000560266.1.52062 WP_000560266.1.52076 WP_000560266.1.52085 WP_000560266.1.52127 WP_000560266.1.52135 WP_000560266.1.52186 WP_000560266.1.52200 WP_000560266.1.52211 WP_000560266.1.52214 WP_000560266.1.52243 WP_000560266.1.52258 WP_000560266.1.5227 WP_000560266.1.52270 WP_000560266.1.52271 WP_000560266.1.52272 WP_000560266.1.52299 WP_000560266.1.52305 WP_000560266.1.52378 WP_000560266.1.5239 WP_000560266.1.52399 WP_000560266.1.52419 WP_000560266.1.52421 WP_000560266.1.52492 WP_000560266.1.52542 WP_000560266.1.52544 WP_000560266.1.52558 WP_000560266.1.52631 WP_000560266.1.52691 WP_000560266.1.52735 WP_000560266.1.52774 WP_000560266.1.52777 WP_000560266.1.52780 WP_000560266.1.52844 WP_000560266.1.52853 WP_000560266.1.52881 WP_000560266.1.52895 WP_000560266.1.5291 WP_000560266.1.52913 WP_000560266.1.52945 WP_000560266.1.52962 WP_000560266.1.53012 WP_000560266.1.53020 WP_000560266.1.53021 WP_000560266.1.5310 WP_000560266.1.53110 WP_000560266.1.53123 WP_000560266.1.532 WP_000560266.1.5322 WP_000560266.1.53228 WP_000560266.1.53242 WP_000560266.1.53251 WP_000560266.1.53262 WP_000560266.1.53327 WP_000560266.1.53356 WP_000560266.1.53364 WP_000560266.1.53377 WP_000560266.1.53401 WP_000560266.1.5342 WP_000560266.1.53428 WP_000560266.1.53482 WP_000560266.1.53505 WP_000560266.1.53537 WP_000560266.1.53557 WP_000560266.1.53590 WP_000560266.1.53592 WP_000560266.1.53687 WP_000560266.1.53769 WP_000560266.1.53866 WP_000560266.1.53931 WP_000560266.1.53940 WP_000560266.1.53966 WP_000560266.1.53972 WP_000560266.1.53994 WP_000560266.1.54002 WP_000560266.1.54013 WP_000560266.1.54023 WP_000560266.1.54032 WP_000560266.1.54051 WP_000560266.1.54091 WP_000560266.1.54144 WP_000560266.1.54188 WP_000560266.1.54208 WP_000560266.1.54263 WP_000560266.1.54307 WP_000560266.1.54313 WP_000560266.1.54329 WP_000560266.1.5434 WP_000560266.1.54344 WP_000560266.1.54411 WP_000560266.1.54417 WP_000560266.1.54429 WP_000560266.1.54476 WP_000560266.1.54507 WP_000560266.1.54524 WP_000560266.1.54534 WP_000560266.1.54546 WP_000560266.1.54590 WP_000560266.1.5460 WP_000560266.1.54602 WP_000560266.1.54605 WP_000560266.1.5461 WP_000560266.1.54617 WP_000560266.1.54620 WP_000560266.1.54625 WP_000560266.1.54695 WP_000560266.1.54754 WP_000560266.1.54755 WP_000560266.1.54769 WP_000560266.1.5478 WP_000560266.1.54817 WP_000560266.1.54918 WP_000560266.1.54981 WP_000560266.1.54989 WP_000560266.1.55003 WP_000560266.1.55005 WP_000560266.1.55009 WP_000560266.1.55070 WP_000560266.1.55197 WP_000560266.1.5520 WP_000560266.1.55203 WP_000560266.1.55222 WP_000560266.1.55357 WP_000560266.1.55417 WP_000560266.1.55420 WP_000560266.1.5546 WP_000560266.1.55507 WP_000560266.1.55529 WP_000560266.1.55551 WP_000560266.1.55556 WP_000560266.1.55560 WP_000560266.1.55571 WP_000560266.1.55574 WP_000560266.1.55608 WP_000560266.1.5561 WP_000560266.1.55629 WP_000560266.1.55676 WP_000560266.1.55720 WP_000560266.1.55731 WP_000560266.1.55757 WP_000560266.1.55787 WP_000560266.1.55790 WP_000560266.1.55808 WP_000560266.1.55825 WP_000560266.1.55844 WP_000560266.1.55868 WP_000560266.1.55888 WP_000560266.1.55896 WP_000560266.1.55936 WP_000560266.1.55988 WP_000560266.1.55990 WP_000560266.1.56047 WP_000560266.1.56122 WP_000560266.1.5614 WP_000560266.1.56149 WP_000560266.1.5616 WP_000560266.1.56164 WP_000560266.1.56193 WP_000560266.1.56197 WP_000560266.1.56285 WP_000560266.1.56293 WP_000560266.1.56302 WP_000560266.1.56358 WP_000560266.1.56390 WP_000560266.1.5646 WP_000560266.1.56523 WP_000560266.1.56662 WP_000560266.1.56665 WP_000560266.1.56680 WP_000560266.1.56689 WP_000560266.1.5670 WP_000560266.1.56742 WP_000560266.1.56799 WP_000560266.1.56835 WP_000560266.1.56846 WP_000560266.1.5685 WP_000560266.1.56882 WP_000560266.1.56932 WP_000560266.1.56934 WP_000560266.1.56941 WP_000560266.1.56978 WP_000560266.1.57011 WP_000560266.1.57045 WP_000560266.1.57072 WP_000560266.1.57086 WP_000560266.1.57100 WP_000560266.1.57124 WP_000560266.1.57150 WP_000560266.1.57159 WP_000560266.1.57181 WP_000560266.1.57202 WP_000560266.1.57213 WP_000560266.1.57222 WP_000560266.1.57281 WP_000560266.1.57348 WP_000560266.1.57395 WP_000560266.1.57401 WP_000560266.1.57403 WP_000560266.1.57410 WP_000560266.1.57414 WP_000560266.1.5742 WP_000560266.1.57432 WP_000560266.1.5755 WP_000560266.1.57558 WP_000560266.1.57608 WP_000560266.1.57638 WP_000560266.1.57669 WP_000560266.1.57812 WP_000560266.1.57832 WP_000560266.1.57846 WP_000560266.1.5786 WP_000560266.1.57904 WP_000560266.1.57994 WP_000560266.1.58001 WP_000560266.1.58022 WP_000560266.1.58038 WP_000560266.1.58080 WP_000560266.1.58092 WP_000560266.1.58097 WP_000560266.1.58136 WP_000560266.1.58146 WP_000560266.1.58163 WP_000560266.1.58172 WP_000560266.1.58226 WP_000560266.1.58232 WP_000560266.1.58233 WP_000560266.1.58267 WP_000560266.1.58292 WP_000560266.1.58340 WP_000560266.1.58345 WP_000560266.1.58401 WP_000560266.1.58408 WP_000560266.1.58414 WP_000560266.1.5842 WP_000560266.1.58420 WP_000560266.1.58429 WP_000560266.1.58440 WP_000560266.1.58507 WP_000560266.1.58528 WP_000560266.1.58617 WP_000560266.1.58705 WP_000560266.1.58837 WP_000560266.1.58867 WP_000560266.1.58901 WP_000560266.1.58940 WP_000560266.1.58958 WP_000560266.1.58976 WP_000560266.1.58983 WP_000560266.1.59024 WP_000560266.1.59026 WP_000560266.1.59035 WP_000560266.1.59047 WP_000560266.1.59060 WP_000560266.1.59119 WP_000560266.1.59165 WP_000560266.1.59174 WP_000560266.1.59190 WP_000560266.1.59226 WP_000560266.1.59280 WP_000560266.1.59292 WP_000560266.1.59302 WP_000560266.1.59306 WP_000560266.1.59395 WP_000560266.1.59407 WP_000560266.1.59409 WP_000560266.1.59413 WP_000560266.1.59423 WP_000560266.1.59434 WP_000560266.1.59483 WP_000560266.1.59513 WP_000560266.1.59533 WP_000560266.1.59553 WP_000560266.1.59579 WP_000560266.1.59590 WP_000560266.1.5965 WP_000560266.1.59699 WP_000560266.1.59730 WP_000560266.1.59756 WP_000560266.1.59781 WP_000560266.1.59782 WP_000560266.1.59815 WP_000560266.1.59823 WP_000560266.1.59877 WP_000560266.1.59912 WP_000560266.1.59970 WP_000560266.1.59998 WP_000560266.1.6002 WP_000560266.1.60031 WP_000560266.1.60070 WP_000560266.1.60096 WP_000560266.1.6022 WP_000560266.1.60228 WP_000560266.1.60325 WP_000560266.1.60342 WP_000560266.1.60343 WP_000560266.1.60350 WP_000560266.1.60436 WP_000560266.1.60477 WP_000560266.1.60498 WP_000560266.1.60544 WP_000560266.1.60550 WP_000560266.1.60555 WP_000560266.1.60576 WP_000560266.1.6059 WP_000560266.1.60606 WP_000560266.1.6061 WP_000560266.1.6064 WP_000560266.1.6066 WP_000560266.1.6068 WP_000560266.1.60717 WP_000560266.1.60764 WP_000560266.1.60805 WP_000560266.1.60835 WP_000560266.1.60895 WP_000560266.1.60901 WP_000560266.1.60927 WP_000560266.1.61006 WP_000560266.1.61008 WP_000560266.1.61035 WP_000560266.1.61058 WP_000560266.1.6106 WP_000560266.1.61096 WP_000560266.1.6110 WP_000560266.1.61102 WP_000560266.1.61112 WP_000560266.1.61121 WP_000560266.1.61132 WP_000560266.1.61170 WP_000560266.1.61174 WP_000560266.1.61183 WP_000560266.1.61225 WP_000560266.1.61241 WP_000560266.1.61292 WP_000560266.1.6138 WP_000560266.1.615 WP_000560266.1.61505 WP_000560266.1.61517 WP_000560266.1.61551 WP_000560266.1.61636 WP_000560266.1.61663 WP_000560266.1.61739 WP_000560266.1.61758 WP_000560266.1.61779 WP_000560266.1.61806 WP_000560266.1.61822 WP_000560266.1.61835 WP_000560266.1.61858 WP_000560266.1.61939 WP_000560266.1.61948 WP_000560266.1.61955 WP_000560266.1.61957 WP_000560266.1.62043 WP_000560266.1.62091 WP_000560266.1.62099 WP_000560266.1.62264 WP_000560266.1.62290 WP_000560266.1.62296 WP_000560266.1.62358 WP_000560266.1.62487 WP_000560266.1.62514 WP_000560266.1.62529 WP_000560266.1.62555 WP_000560266.1.62586 WP_000560266.1.62612 WP_000560266.1.62631 WP_000560266.1.62642 WP_000560266.1.62646 WP_000560266.1.62714 WP_000560266.1.62735 WP_000560266.1.62750 WP_000560266.1.62762 WP_000560266.1.62780 WP_000560266.1.62787 WP_000560266.1.62812 WP_000560266.1.62840 WP_000560266.1.62851 WP_000560266.1.62885 WP_000560266.1.62914 WP_000560266.1.62919 WP_000560266.1.6293 WP_000560266.1.62959 WP_000560266.1.62989 WP_000560266.1.6299 WP_000560266.1.63078 WP_000560266.1.63167 WP_000560266.1.63189 WP_000560266.1.6323 WP_000560266.1.63305 WP_000560266.1.63310 WP_000560266.1.63330 WP_000560266.1.63350 WP_000560266.1.6337 WP_000560266.1.63370 WP_000560266.1.63374 WP_000560266.1.63419 WP_000560266.1.63433 WP_000560266.1.63437 WP_000560266.1.63453 WP_000560266.1.63465 WP_000560266.1.63467 WP_000560266.1.63478 WP_000560266.1.63496 WP_000560266.1.63554 WP_000560266.1.63556 WP_000560266.1.63576 WP_000560266.1.63612 WP_000560266.1.63679 WP_000560266.1.63703 WP_000560266.1.63944 WP_000560266.1.64008 WP_000560266.1.64014 WP_000560266.1.64040 WP_000560266.1.64045 WP_000560266.1.64050 WP_000560266.1.64074 WP_000560266.1.64080 WP_000560266.1.64110 WP_000560266.1.64153 WP_000560266.1.64165 WP_000560266.1.64180 WP_000560266.1.64193 WP_000560266.1.64285 WP_000560266.1.64286 WP_000560266.1.643 WP_000560266.1.6431 WP_000560266.1.64321 WP_000560266.1.64353 WP_000560266.1.64356 WP_000560266.1.64380 WP_000560266.1.6444 WP_000560266.1.64448 WP_000560266.1.64519 WP_000560266.1.64547 WP_000560266.1.64670 WP_000560266.1.647 WP_000560266.1.64707 WP_000560266.1.64712 WP_000560266.1.64746 WP_000560266.1.64784 WP_000560266.1.64789 WP_000560266.1.64793 WP_000560266.1.64840 WP_000560266.1.64881 WP_000560266.1.64912 WP_000560266.1.64930 WP_000560266.1.64970 WP_000560266.1.6500 WP_000560266.1.65023 WP_000560266.1.65061 WP_000560266.1.65097 WP_000560266.1.65104 WP_000560266.1.65122 WP_000560266.1.65240 WP_000560266.1.6527 WP_000560266.1.65271 WP_000560266.1.65306 WP_000560266.1.65353 WP_000560266.1.65364 WP_000560266.1.65370 WP_000560266.1.654 WP_000560266.1.65408 WP_000560266.1.65415 WP_000560266.1.65456 WP_000560266.1.65484 WP_000560266.1.65531 WP_000560266.1.65565 WP_000560266.1.65596 WP_000560266.1.65662 WP_000560266.1.65672 WP_000560266.1.6576 WP_000560266.1.65762 WP_000560266.1.65834 WP_000560266.1.65912 WP_000560266.1.65957 WP_000560266.1.65961 WP_000560266.1.65962 WP_000560266.1.6599 WP_000560266.1.66001 WP_000560266.1.66007 WP_000560266.1.66022 WP_000560266.1.66050 WP_000560266.1.66059 WP_000560266.1.66104 WP_000560266.1.66105 WP_000560266.1.66127 WP_000560266.1.66187 WP_000560266.1.66197 WP_000560266.1.66251 WP_000560266.1.66280 WP_000560266.1.66288 WP_000560266.1.66327 WP_000560266.1.6635 WP_000560266.1.66387 WP_000560266.1.66389 WP_000560266.1.66392 WP_000560266.1.66395 WP_000560266.1.66421 WP_000560266.1.66448 WP_000560266.1.66501 WP_000560266.1.66523 WP_000560266.1.6654 WP_000560266.1.66550 WP_000560266.1.66559 WP_000560266.1.66624 WP_000560266.1.66644 WP_000560266.1.6665 WP_000560266.1.6666 WP_000560266.1.66700 WP_000560266.1.66706 WP_000560266.1.66708 WP_000560266.1.66719 WP_000560266.1.66727 WP_000560266.1.6676 WP_000560266.1.66787 WP_000560266.1.66794 WP_000560266.1.66796 WP_000560266.1.66849 WP_000560266.1.66933 WP_000560266.1.66948 WP_000560266.1.66978 WP_000560266.1.6701 WP_000560266.1.67018 WP_000560266.1.67022 WP_000560266.1.67029 WP_000560266.1.67102 WP_000560266.1.67116 WP_000560266.1.67132 WP_000560266.1.67164 WP_000560266.1.67200 WP_000560266.1.67209 WP_000560266.1.6723 WP_000560266.1.67293 WP_000560266.1.6735 WP_000560266.1.67383 WP_000560266.1.67412 WP_000560266.1.67415 WP_000560266.1.67451 WP_000560266.1.67454 WP_000560266.1.67456 WP_000560266.1.67468 WP_000560266.1.67522 WP_000560266.1.67538 WP_000560266.1.67549 WP_000560266.1.67553 WP_000560266.1.67581 WP_000560266.1.67590 WP_000560266.1.67660 WP_000560266.1.67669 WP_000560266.1.67681 WP_000560266.1.67685 WP_000560266.1.67701 WP_000560266.1.67724 WP_000560266.1.67732 WP_000560266.1.67760 WP_000560266.1.67786 WP_000560266.1.67787 WP_000560266.1.67788 WP_000560266.1.678 WP_000560266.1.67802 WP_000560266.1.67853 WP_000560266.1.67861 WP_000560266.1.67891 WP_000560266.1.67990 WP_000560266.1.67999 WP_000560266.1.68008 WP_000560266.1.6802 WP_000560266.1.68025 WP_000560266.1.6803 WP_000560266.1.68052 WP_000560266.1.68063 WP_000560266.1.68079 WP_000560266.1.6814 WP_000560266.1.68170 WP_000560266.1.68175 WP_000560266.1.682 WP_000560266.1.68215 WP_000560266.1.68278 WP_000560266.1.68283 WP_000560266.1.68300 WP_000560266.1.68336 WP_000560266.1.68341 WP_000560266.1.68396 WP_000560266.1.68534 WP_000560266.1.6860 WP_000560266.1.68609 WP_000560266.1.68632 WP_000560266.1.68697 WP_000560266.1.68701 WP_000560266.1.68711 WP_000560266.1.6877 WP_000560266.1.68793 WP_000560266.1.68797 WP_000560266.1.68838 WP_000560266.1.68942 WP_000560266.1.68952 WP_000560266.1.68956 WP_000560266.1.6897 WP_000560266.1.68989 WP_000560266.1.69098 WP_000560266.1.69144 WP_000560266.1.6916 WP_000560266.1.69247 WP_000560266.1.69261 WP_000560266.1.69303 WP_000560266.1.69305 WP_000560266.1.69382 WP_000560266.1.69390 WP_000560266.1.69404 WP_000560266.1.69438 WP_000560266.1.6945 WP_000560266.1.69450 WP_000560266.1.69472 WP_000560266.1.69473 WP_000560266.1.69506 WP_000560266.1.69583 WP_000560266.1.69593 WP_000560266.1.69646 WP_000560266.1.69649 WP_000560266.1.697 WP_000560266.1.69803 WP_000560266.1.69831 WP_000560266.1.69832 WP_000560266.1.69868 WP_000560266.1.69963 WP_000560266.1.69972 WP_000560266.1.69999 WP_000560266.1.70063 WP_000560266.1.701 WP_000560266.1.70149 WP_000560266.1.7015 WP_000560266.1.70191 WP_000560266.1.70200 WP_000560266.1.70213 WP_000560266.1.70230 WP_000560266.1.70251 WP_000560266.1.70337 WP_000560266.1.70341 WP_000560266.1.70357 WP_000560266.1.70407 WP_000560266.1.7052 WP_000560266.1.70563 WP_000560266.1.70619 WP_000560266.1.70628 WP_000560266.1.70686 WP_000560266.1.70767 WP_000560266.1.70794 WP_000560266.1.70801 WP_000560266.1.70880 WP_000560266.1.7090 WP_000560266.1.70900 WP_000560266.1.71024 WP_000560266.1.71109 WP_000560266.1.71113 WP_000560266.1.71134 WP_000560266.1.71147 WP_000560266.1.71158 WP_000560266.1.71159 WP_000560266.1.71183 WP_000560266.1.71199 WP_000560266.1.71229 WP_000560266.1.71275 WP_000560266.1.71287 WP_000560266.1.71312 WP_000560266.1.71315 WP_000560266.1.71323 WP_000560266.1.71327 WP_000560266.1.71339 WP_000560266.1.71354 WP_000560266.1.71397 WP_000560266.1.71405 WP_000560266.1.71421 WP_000560266.1.71480 WP_000560266.1.71533 WP_000560266.1.71537 WP_000560266.1.71538 WP_000560266.1.71632 WP_000560266.1.71690 WP_000560266.1.71724 WP_000560266.1.71767 WP_000560266.1.71783 WP_000560266.1.71837 WP_000560266.1.71874 WP_000560266.1.7192 WP_000560266.1.71938 WP_000560266.1.71944 WP_000560266.1.71967 WP_000560266.1.71975 WP_000560266.1.71993 WP_000560266.1.72021 WP_000560266.1.72033 WP_000560266.1.72066 WP_000560266.1.7210 WP_000560266.1.72117 WP_000560266.1.72157 WP_000560266.1.72162 WP_000560266.1.72184 WP_000560266.1.72186 WP_000560266.1.72237 WP_000560266.1.72240 WP_000560266.1.72248 WP_000560266.1.7225 WP_000560266.1.72258 WP_000560266.1.72261 WP_000560266.1.72270 WP_000560266.1.72290 WP_000560266.1.72298 WP_000560266.1.723 WP_000560266.1.72316 WP_000560266.1.72337 WP_000560266.1.72342 WP_000560266.1.72397 WP_000560266.1.72425 WP_000560266.1.72431 WP_000560266.1.72436 WP_000560266.1.72449 WP_000560266.1.72485 WP_000560266.1.72493 WP_000560266.1.72507 WP_000560266.1.72511 WP_000560266.1.72521 WP_000560266.1.72522 WP_000560266.1.72537 WP_000560266.1.72551 WP_000560266.1.72582 WP_000560266.1.72599 WP_000560266.1.72608 WP_000560266.1.72652 WP_000560266.1.72695 WP_000560266.1.72698 WP_000560266.1.72725 WP_000560266.1.72729 WP_000560266.1.72745 WP_000560266.1.72747 WP_000560266.1.72748 WP_000560266.1.72751 WP_000560266.1.7277 WP_000560266.1.72858 WP_000560266.1.72860 WP_000560266.1.72910 WP_000560266.1.72947 WP_000560266.1.72962 WP_000560266.1.73032 WP_000560266.1.73039 WP_000560266.1.73072 WP_000560266.1.73075 WP_000560266.1.73085 WP_000560266.1.73094 WP_000560266.1.73217 WP_000560266.1.73230 WP_000560266.1.73249 WP_000560266.1.73257 WP_000560266.1.73259 WP_000560266.1.73292 WP_000560266.1.73295 WP_000560266.1.73326 WP_000560266.1.73349 WP_000560266.1.73385 WP_000560266.1.7345 WP_000560266.1.73524 WP_000560266.1.73565 WP_000560266.1.73572 WP_000560266.1.73604 WP_000560266.1.73663 WP_000560266.1.73709 WP_000560266.1.73717 WP_000560266.1.7376 WP_000560266.1.73797 WP_000560266.1.73807 WP_000560266.1.73827 WP_000560266.1.73835 WP_000560266.1.73843 WP_000560266.1.73844 WP_000560266.1.73859 WP_000560266.1.73908 WP_000560266.1.73942 WP_000560266.1.74032 WP_000560266.1.74041 WP_000560266.1.7411 WP_000560266.1.74123 WP_000560266.1.7413 WP_000560266.1.74156 WP_000560266.1.74184 WP_000560266.1.74185 WP_000560266.1.7424 WP_000560266.1.7425 WP_000560266.1.74267 WP_000560266.1.74309 WP_000560266.1.74358 WP_000560266.1.74365 WP_000560266.1.74431 WP_000560266.1.74445 WP_000560266.1.74501 WP_000560266.1.74513 WP_000560266.1.74528 WP_000560266.1.74532 WP_000560266.1.7461 WP_000560266.1.74625 WP_000560266.1.74652 WP_000560266.1.74670 WP_000560266.1.74687 WP_000560266.1.74689 WP_000560266.1.74691 WP_000560266.1.74713 WP_000560266.1.74735 WP_000560266.1.7475 WP_000560266.1.74752 WP_000560266.1.74844 WP_000560266.1.74852 WP_000560266.1.74885 WP_000560266.1.74889 WP_000560266.1.74915 WP_000560266.1.74998 WP_000560266.1.75021 WP_000560266.1.75087 WP_000560266.1.75118 WP_000560266.1.75124 WP_000560266.1.75136 WP_000560266.1.75139 WP_000560266.1.75149 WP_000560266.1.7516 WP_000560266.1.75181 WP_000560266.1.75209 WP_000560266.1.75228 WP_000560266.1.75243 WP_000560266.1.75306 WP_000560266.1.75360 WP_000560266.1.75367 WP_000560266.1.75428 WP_000560266.1.75435 WP_000560266.1.75465 WP_000560266.1.75491 WP_000560266.1.75505 WP_000560266.1.75515 WP_000560266.1.75529 WP_000560266.1.75537 WP_000560266.1.75557 WP_000560266.1.75588 WP_000560266.1.75594 WP_000560266.1.75612 WP_000560266.1.75644 WP_000560266.1.75653 WP_000560266.1.75676 WP_000560266.1.75679 WP_000560266.1.75687 WP_000560266.1.75696 WP_000560266.1.75758 WP_000560266.1.75892 WP_000560266.1.7597 WP_000560266.1.75973 WP_000560266.1.75983 WP_000560266.1.75995 WP_000560266.1.76005 WP_000560266.1.76019 WP_000560266.1.76039 WP_000560266.1.7617 WP_000560266.1.76196 WP_000560266.1.76211 WP_000560266.1.76237 WP_000560266.1.76269 WP_000560266.1.76312 WP_000560266.1.76325 WP_000560266.1.76387 WP_000560266.1.76446 WP_000560266.1.76447 WP_000560266.1.76462 WP_000560266.1.76504 WP_000560266.1.76542 WP_000560266.1.76562 WP_000560266.1.76595 WP_000560266.1.76596 WP_000560266.1.76656 WP_000560266.1.76660 WP_000560266.1.76701 WP_000560266.1.76707 WP_000560266.1.76712 WP_000560266.1.76759 WP_000560266.1.76815 WP_000560266.1.76840 WP_000560266.1.76863 WP_000560266.1.7689 WP_000560266.1.76918 WP_000560266.1.76948 WP_000560266.1.76957 WP_000560266.1.76961 WP_000560266.1.76966 WP_000560266.1.76994 WP_000560266.1.77015 WP_000560266.1.77022 WP_000560266.1.77036 WP_000560266.1.77042 WP_000560266.1.77057 WP_000560266.1.77109 WP_000560266.1.77162 WP_000560266.1.77175 WP_000560266.1.77198 WP_000560266.1.77204 WP_000560266.1.7728 WP_000560266.1.7729 WP_000560266.1.77358 WP_000560266.1.77408 WP_000560266.1.77455 WP_000560266.1.77462 WP_000560266.1.77471 WP_000560266.1.77481 WP_000560266.1.7750 WP_000560266.1.77503 WP_000560266.1.7756 WP_000560266.1.77581 WP_000560266.1.77595 WP_000560266.1.77608 WP_000560266.1.77636 WP_000560266.1.77643 WP_000560266.1.77648 WP_000560266.1.77767 WP_000560266.1.77768 WP_000560266.1.7781 WP_000560266.1.77813 WP_000560266.1.77816 WP_000560266.1.77826 WP_000560266.1.77833 WP_000560266.1.77876 WP_000560266.1.77929 WP_000560266.1.77949 WP_000560266.1.77999 WP_000560266.1.78000 WP_000560266.1.7804 WP_000560266.1.78041 WP_000560266.1.78089 WP_000560266.1.78183 WP_000560266.1.78196 WP_000560266.1.78232 WP_000560266.1.78321 WP_000560266.1.78368 WP_000560266.1.78376 WP_000560266.1.78377 WP_000560266.1.78413 WP_000560266.1.78445 WP_000560266.1.78463 WP_000560266.1.7847 WP_000560266.1.78481 WP_000560266.1.78512 WP_000560266.1.78515 WP_000560266.1.78583 WP_000560266.1.78586 WP_000560266.1.78612 WP_000560266.1.78615 WP_000560266.1.78677 WP_000560266.1.78687 WP_000560266.1.78689 WP_000560266.1.78698 WP_000560266.1.78718 WP_000560266.1.78750 WP_000560266.1.78757 WP_000560266.1.78773 WP_000560266.1.78775 WP_000560266.1.78791 WP_000560266.1.7883 WP_000560266.1.78843 WP_000560266.1.78888 WP_000560266.1.78895 WP_000560266.1.78919 WP_000560266.1.78953 WP_000560266.1.78955 WP_000560266.1.78956 WP_000560266.1.7896 WP_000560266.1.78966 WP_000560266.1.7898 WP_000560266.1.79001 WP_000560266.1.79004 WP_000560266.1.79067 WP_000560266.1.79086 WP_000560266.1.79100 WP_000560266.1.79246 WP_000560266.1.79306 WP_000560266.1.79312 WP_000560266.1.79342 WP_000560266.1.79343 WP_000560266.1.79346 WP_000560266.1.79356 WP_000560266.1.79365 WP_000560266.1.7937 WP_000560266.1.79391 WP_000560266.1.79409 WP_000560266.1.79414 WP_000560266.1.79478 WP_000560266.1.79525 WP_000560266.1.79540 WP_000560266.1.79558 WP_000560266.1.79591 WP_000560266.1.79606 WP_000560266.1.79685 WP_000560266.1.79713 WP_000560266.1.79764 WP_000560266.1.79816 WP_000560266.1.79824 WP_000560266.1.79840 WP_000560266.1.7985 WP_000560266.1.7987 WP_000560266.1.79871 WP_000560266.1.79877 WP_000560266.1.79930 WP_000560266.1.79931 WP_000560266.1.79936 WP_000560266.1.79952 WP_000560266.1.79955 WP_000560266.1.79984 WP_000560266.1.80016 WP_000560266.1.80050 WP_000560266.1.80060 WP_000560266.1.80061 WP_000560266.1.80063 WP_000560266.1.80106 WP_000560266.1.8011 WP_000560266.1.80112 WP_000560266.1.80136 WP_000560266.1.80141 WP_000560266.1.80168 WP_000560266.1.80255 WP_000560266.1.80310 WP_000560266.1.80320 WP_000560266.1.80426 WP_000560266.1.80428 WP_000560266.1.80440 WP_000560266.1.80444 WP_000560266.1.80463 WP_000560266.1.80517 WP_000560266.1.80519 WP_000560266.1.80559 WP_000560266.1.8057 WP_000560266.1.80577 WP_000560266.1.80612 WP_000560266.1.80660 WP_000560266.1.80666 WP_000560266.1.80709 WP_000560266.1.80737 WP_000560266.1.80753 WP_000560266.1.80756 WP_000560266.1.8076 WP_000560266.1.80804 WP_000560266.1.80884 WP_000560266.1.8090 WP_000560266.1.80945 WP_000560266.1.80948 WP_000560266.1.80966 WP_000560266.1.80985 WP_000560266.1.810 WP_000560266.1.81026 WP_000560266.1.81034 WP_000560266.1.81036 WP_000560266.1.81054 WP_000560266.1.81098 WP_000560266.1.81165 WP_000560266.1.8121 WP_000560266.1.81219 WP_000560266.1.81266 WP_000560266.1.81313 WP_000560266.1.81323 WP_000560266.1.81376 WP_000560266.1.81391 WP_000560266.1.814 WP_000560266.1.81438 WP_000560266.1.81475 WP_000560266.1.81517 WP_000560266.1.81576 WP_000560266.1.81577 WP_000560266.1.81580 WP_000560266.1.81582 WP_000560266.1.81589 WP_000560266.1.81618 WP_000560266.1.81625 WP_000560266.1.81715 WP_000560266.1.81723 WP_000560266.1.81761 WP_000560266.1.81806 WP_000560266.1.81832 WP_000560266.1.81869 WP_000560266.1.81876 WP_000560266.1.81914 WP_000560266.1.81939 WP_000560266.1.81956 WP_000560266.1.81972 WP_000560266.1.82 WP_000560266.1.82008 WP_000560266.1.82062 WP_000560266.1.82074 WP_000560266.1.82104 WP_000560266.1.82137 WP_000560266.1.82217 WP_000560266.1.82221 WP_000560266.1.82242 WP_000560266.1.82275 WP_000560266.1.82316 WP_000560266.1.8235 WP_000560266.1.82439 WP_000560266.1.82507 WP_000560266.1.82536 WP_000560266.1.82539 WP_000560266.1.82572 WP_000560266.1.82626 WP_000560266.1.82647 WP_000560266.1.82700 WP_000560266.1.82715 WP_000560266.1.82718 WP_000560266.1.82754 WP_000560266.1.8277 WP_000560266.1.82799 WP_000560266.1.82831 WP_000560266.1.82833 WP_000560266.1.82853 WP_000560266.1.82991 WP_000560266.1.83020 WP_000560266.1.83035 WP_000560266.1.83036 WP_000560266.1.8306 WP_000560266.1.8308 WP_000560266.1.83097 WP_000560266.1.831 WP_000560266.1.83125 WP_000560266.1.83140 WP_000560266.1.83144 WP_000560266.1.83205 WP_000560266.1.83224 WP_000560266.1.83256 WP_000560266.1.83286 WP_000560266.1.83321 WP_000560266.1.83340 WP_000560266.1.83375 WP_000560266.1.8345 WP_000560266.1.83537 WP_000560266.1.83564 WP_000560266.1.83584 WP_000560266.1.83644 WP_000560266.1.83735 WP_000560266.1.83781 WP_000560266.1.83807 WP_000560266.1.83820 WP_000560266.1.8386 WP_000560266.1.83941 WP_000560266.1.84014 WP_000560266.1.84021 WP_000560266.1.8405 WP_000560266.1.84060 WP_000560266.1.8411 WP_000560266.1.84140 WP_000560266.1.84164 WP_000560266.1.84210 WP_000560266.1.84331 WP_000560266.1.84339 WP_000560266.1.84405 WP_000560266.1.84410 WP_000560266.1.8444 WP_000560266.1.84467 WP_000560266.1.84476 WP_000560266.1.84484 WP_000560266.1.84486 WP_000560266.1.84534 WP_000560266.1.84584 WP_000560266.1.84656 WP_000560266.1.84668 WP_000560266.1.8470 WP_000560266.1.84738 WP_000560266.1.84740 WP_000560266.1.84784 WP_000560266.1.84797 WP_000560266.1.84877 WP_000560266.1.84881 WP_000560266.1.84894 WP_000560266.1.84929 WP_000560266.1.84941 WP_000560266.1.84977 WP_000560266.1.84986 WP_000560266.1.84989 WP_000560266.1.84990 WP_000560266.1.84994 WP_000560266.1.85002 WP_000560266.1.85008 WP_000560266.1.85025 WP_000560266.1.85048 WP_000560266.1.85085 WP_000560266.1.85090 WP_000560266.1.85098 WP_000560266.1.85125 WP_000560266.1.8517 WP_000560266.1.85175 WP_000560266.1.85247 WP_000560266.1.85252 WP_000560266.1.85255 WP_000560266.1.85260 WP_000560266.1.8530 WP_000560266.1.85310 WP_000560266.1.85323 WP_000560266.1.85336 WP_000560266.1.85416 WP_000560266.1.85435 WP_000560266.1.85504 WP_000560266.1.85525 WP_000560266.1.85554 WP_000560266.1.85556 WP_000560266.1.85578 WP_000560266.1.85593 WP_000560266.1.8560 WP_000560266.1.85621 WP_000560266.1.85657 WP_000560266.1.85752 WP_000560266.1.85762 WP_000560266.1.85773 WP_000560266.1.85781 WP_000560266.1.8579 WP_000560266.1.85857 WP_000560266.1.8592 WP_000560266.1.85944 WP_000560266.1.85948 WP_000560266.1.85969 WP_000560266.1.86001 WP_000560266.1.86035 WP_000560266.1.86149 WP_000560266.1.86166 WP_000560266.1.8621 WP_000560266.1.86210 WP_000560266.1.86228 WP_000560266.1.86261 WP_000560266.1.86266 WP_000560266.1.86273 WP_000560266.1.86283 WP_000560266.1.86353 WP_000560266.1.86355 WP_000560266.1.86364 WP_000560266.1.86371 WP_000560266.1.86376 WP_000560266.1.86411 WP_000560266.1.86412 WP_000560266.1.86451 WP_000560266.1.86452 WP_000560266.1.86454 WP_000560266.1.86461 WP_000560266.1.86475 WP_000560266.1.86483 WP_000560266.1.86492 WP_000560266.1.8656 WP_000560266.1.86560 WP_000560266.1.86583 WP_000560266.1.86598 WP_000560266.1.86609 WP_000560266.1.86613 WP_000560266.1.86617 WP_000560266.1.86627 WP_000560266.1.86640 WP_000560266.1.86691 WP_000560266.1.86731 WP_000560266.1.86787 WP_000560266.1.86788 WP_000560266.1.86848 WP_000560266.1.86956 WP_000560266.1.86959 WP_000560266.1.86997 WP_000560266.1.87075 WP_000560266.1.8711 WP_000560266.1.87189 WP_000560266.1.87199 WP_000560266.1.87249 WP_000560266.1.87310 WP_000560266.1.87358 WP_000560266.1.87389 WP_000560266.1.87400 WP_000560266.1.87443 WP_000560266.1.87563 WP_000560266.1.87568 WP_000560266.1.87574 WP_000560266.1.87607 WP_000560266.1.87655 WP_000560266.1.87696 WP_000560266.1.87721 WP_000560266.1.87726 WP_000560266.1.87738 WP_000560266.1.87766 WP_000560266.1.87788 WP_000560266.1.87789 WP_000560266.1.87914 WP_000560266.1.87919 WP_000560266.1.87980 WP_000560266.1.88017 WP_000560266.1.88020 WP_000560266.1.8807 WP_000560266.1.88082 WP_000560266.1.88088 WP_000560266.1.88110 WP_000560266.1.88149 WP_000560266.1.88155 WP_000560266.1.88238 WP_000560266.1.88263 WP_000560266.1.88301 WP_000560266.1.88304 WP_000560266.1.88376 WP_000560266.1.88434 WP_000560266.1.8848 WP_000560266.1.88527 WP_000560266.1.88535 WP_000560266.1.88607 WP_000560266.1.88631 WP_000560266.1.88686 WP_000560266.1.88709 WP_000560266.1.88710 WP_000560266.1.88711 WP_000560266.1.88729 WP_000560266.1.8873 WP_000560266.1.88732 WP_000560266.1.88735 WP_000560266.1.88767 WP_000560266.1.8879 WP_000560266.1.88793 WP_000560266.1.88826 WP_000560266.1.88834 WP_000560266.1.88880 WP_000560266.1.88941 WP_000560266.1.88950 WP_000560266.1.88961 WP_000560266.1.89043 WP_000560266.1.8906 WP_000560266.1.89067 WP_000560266.1.89099 WP_000560266.1.89150 WP_000560266.1.89217 WP_000560266.1.8928 WP_000560266.1.89285 WP_000560266.1.89305 WP_000560266.1.89312 WP_000560266.1.89379 WP_000560266.1.89396 WP_000560266.1.894 WP_000560266.1.89416 WP_000560266.1.89432 WP_000560266.1.8945 WP_000560266.1.89455 WP_000560266.1.89458 WP_000560266.1.89468 WP_000560266.1.89469 WP_000560266.1.89492 WP_000560266.1.89627 WP_000560266.1.89630 WP_000560266.1.89674 WP_000560266.1.89679 WP_000560266.1.89710 WP_000560266.1.89818 WP_000560266.1.89839 WP_000560266.1.8985 WP_000560266.1.89899 WP_000560266.1.89923 WP_000560266.1.89977 WP_000560266.1.90017 WP_000560266.1.90065 WP_000560266.1.90078 WP_000560266.1.9009 WP_000560266.1.90128 WP_000560266.1.90146 WP_000560266.1.902 WP_000560266.1.90314 WP_000560266.1.90332 WP_000560266.1.90357 WP_000560266.1.90358 WP_000560266.1.9036 WP_000560266.1.9037 WP_000560266.1.90389 WP_000560266.1.90511 WP_000560266.1.90520 WP_000560266.1.90525 WP_000560266.1.90536 WP_000560266.1.9059 WP_000560266.1.90690 WP_000560266.1.90703 WP_000560266.1.90775 WP_000560266.1.90799 WP_000560266.1.9081 WP_000560266.1.90813 WP_000560266.1.90828 WP_000560266.1.90839 WP_000560266.1.90842 WP_000560266.1.90844 WP_000560266.1.90856 WP_000560266.1.90890 WP_000560266.1.90905 WP_000560266.1.90951 WP_000560266.1.90960 WP_000560266.1.90996 WP_000560266.1.91007 WP_000560266.1.91018 WP_000560266.1.91170 WP_000560266.1.91182 WP_000560266.1.91220 WP_000560266.1.91266 WP_000560266.1.91268 WP_000560266.1.91277 WP_000560266.1.91290 WP_000560266.1.91340 WP_000560266.1.91341 WP_000560266.1.91414 WP_000560266.1.91462 WP_000560266.1.91485 WP_000560266.1.91511 WP_000560266.1.91515 WP_000560266.1.91551 WP_000560266.1.91566 WP_000560266.1.9157 WP_000560266.1.91596 WP_000560266.1.91643 WP_000560266.1.91666 WP_000560266.1.91685 WP_000560266.1.9169 WP_000560266.1.91739 WP_000560266.1.91756 WP_000560266.1.91863 WP_000560266.1.91893 WP_000560266.1.91971 WP_000560266.1.91994 WP_000560266.1.92005 WP_000560266.1.92025 WP_000560266.1.92031 WP_000560266.1.9209 WP_000560266.1.92096 WP_000560266.1.921 WP_000560266.1.92102 WP_000560266.1.92123 WP_000560266.1.9215 WP_000560266.1.92161 WP_000560266.1.92180 WP_000560266.1.92215 WP_000560266.1.92224 WP_000560266.1.92276 WP_000560266.1.92295 WP_000560266.1.92311 WP_000560266.1.92361 WP_000560266.1.92434 WP_000560266.1.92496 WP_000560266.1.92532 WP_000560266.1.9255 WP_000560266.1.92568 WP_000560266.1.92614 WP_000560266.1.92615 WP_000560266.1.92668 WP_000560266.1.92693 WP_000560266.1.92708 WP_000560266.1.92719 WP_000560266.1.92742 WP_000560266.1.92750 WP_000560266.1.92767 WP_000560266.1.92780 WP_000560266.1.92781 WP_000560266.1.92792 WP_000560266.1.92845 WP_000560266.1.92865 WP_000560266.1.92943 WP_000560266.1.93019 WP_000560266.1.93023 WP_000560266.1.93033 WP_000560266.1.93048 WP_000560266.1.93054 WP_000560266.1.93072 WP_000560266.1.93133 WP_000560266.1.93139 WP_000560266.1.93167 WP_000560266.1.93175 WP_000560266.1.93233 WP_000560266.1.93276 WP_000560266.1.93312 WP_000560266.1.93338 WP_000560266.1.93379 WP_000560266.1.934 WP_000560266.1.93453 WP_000560266.1.93461 WP_000560266.1.9356 WP_000560266.1.93605 WP_000560266.1.93626 WP_000560266.1.93634 WP_000560266.1.93637 WP_000560266.1.93639 WP_000560266.1.93652 WP_000560266.1.93673 WP_000560266.1.93743 WP_000560266.1.93745 WP_000560266.1.93755 WP_000560266.1.93765 WP_000560266.1.93768 WP_000560266.1.93870 WP_000560266.1.93877 WP_000560266.1.93911 WP_000560266.1.93918 WP_000560266.1.93952 WP_000560266.1.93971 WP_000560266.1.94008 WP_000560266.1.94025 WP_000560266.1.94040 WP_000560266.1.94057 WP_000560266.1.94176 WP_000560266.1.94190 WP_000560266.1.94271 WP_000560266.1.94298 WP_000560266.1.94353 WP_000560266.1.94388 WP_000560266.1.94438 WP_000560266.1.94445 WP_000560266.1.94468 WP_000560266.1.94507 WP_000560266.1.94542 WP_000560266.1.94548 WP_000560266.1.9457 WP_000560266.1.94619 WP_000560266.1.94646 WP_000560266.1.94692 WP_000560266.1.94738 WP_000560266.1.9474 WP_000560266.1.94764 WP_000560266.1.948 WP_000560266.1.94806 WP_000560266.1.94808 WP_000560266.1.94822 WP_000560266.1.94869 WP_000560266.1.9489 WP_000560266.1.94898 WP_000560266.1.94903 WP_000560266.1.9491 WP_000560266.1.94938 WP_000560266.1.94949 WP_000560266.1.94993 WP_000560266.1.95037 WP_000560266.1.95084 WP_000560266.1.9513 WP_000560266.1.95244 WP_000560266.1.95254 WP_000560266.1.95275 WP_000560266.1.95332 WP_000560266.1.95364 WP_000560266.1.95381 WP_000560266.1.95395 WP_000560266.1.95398 WP_000560266.1.95438 WP_000560266.1.95449 WP_000560266.1.95563 WP_000560266.1.9559 WP_000560266.1.95595 WP_000560266.1.95604 WP_000560266.1.95628 WP_000560266.1.95655 WP_000560266.1.95771 WP_000560266.1.95784 WP_000560266.1.95801 WP_000560266.1.95824 WP_000560266.1.95827 WP_000560266.1.95849 WP_000560266.1.95869 WP_000560266.1.95919 WP_000560266.1.96015 WP_000560266.1.96053 WP_000560266.1.96114 WP_000560266.1.96128 WP_000560266.1.96177 WP_000560266.1.96215 WP_000560266.1.96222 WP_000560266.1.96229 WP_000560266.1.96247 WP_000560266.1.96263 WP_000560266.1.96279 WP_000560266.1.96299 WP_000560266.1.96303 WP_000560266.1.96339 WP_000560266.1.96341 WP_000560266.1.96394 WP_000560266.1.96417 WP_000560266.1.96457 WP_000560266.1.96479 WP_000560266.1.9649 WP_000560266.1.965 WP_000560266.1.96541 WP_000560266.1.96558 WP_000560266.1.9657 WP_000560266.1.96585 WP_000560266.1.96608 WP_000560266.1.9661 WP_000560266.1.96659 WP_000560266.1.96680 WP_000560266.1.96762 WP_000560266.1.96769 WP_000560266.1.9682 WP_000560266.1.9690 WP_000560266.1.96924 WP_000560266.1.96932 WP_000560266.1.96936 WP_000560266.1.96944 WP_000560266.1.96984 WP_000560266.1.97049 WP_000560266.1.97059 WP_000560266.1.97123 WP_000560266.1.97170 WP_000560266.1.97200 WP_000560266.1.97231 WP_000560266.1.97238 WP_000560266.1.97248 WP_000560266.1.97279 WP_000560266.1.97292 WP_000560266.1.97344 WP_000560266.1.97360 WP_000560266.1.97361 WP_000560266.1.97418 WP_000560266.1.97421 WP_000560266.1.97434 WP_000560266.1.9747 WP_000560266.1.97490 WP_000560266.1.97544 WP_000560266.1.97549 WP_000560266.1.97619 WP_000560266.1.97667 WP_000560266.1.97677 WP_000560266.1.97685 WP_000560266.1.97705 WP_000560266.1.97798 WP_000560266.1.97815 WP_000560266.1.97823 WP_000560266.1.97825 WP_000560266.1.97930 WP_000560266.1.97932 WP_000560266.1.97937 WP_000560266.1.97996 WP_000560266.1.98026 WP_000560266.1.98082 WP_000560266.1.98202 WP_000560266.1.98232 WP_000560266.1.98235 WP_000560266.1.98241 WP_000560266.1.98251 WP_000560266.1.98292 WP_000560266.1.98294 WP_000560266.1.98301 WP_000560266.1.98323 WP_000560266.1.98355 WP_000560266.1.98357 WP_000560266.1.98424 WP_000560266.1.9844 WP_000560266.1.98442 WP_000560266.1.98451 WP_000560266.1.98477 WP_000560266.1.98484 WP_000560266.1.98549 WP_000560266.1.98578 WP_000560266.1.9858 WP_000560266.1.98628 WP_000560266.1.98654 WP_000560266.1.98683 WP_000560266.1.98757 WP_000560266.1.98776 WP_000560266.1.98849 WP_000560266.1.98875 WP_000560266.1.99006 WP_000560266.1.99046 WP_000560266.1.99060 WP_000560266.1.99119 WP_000560266.1.99209 WP_000560266.1.99246 WP_000560266.1.99265 WP_000560266.1.99292 WP_000560266.1.9930 WP_000560266.1.99304 WP_000560266.1.99306 WP_000560266.1.99319 WP_000560266.1.99334 WP_000560266.1.9935 WP_000560266.1.99361 WP_000560266.1.99392 WP_000560266.1.9940 WP_000560266.1.99400 WP_000560266.1.99458 WP_000560266.1.99475 WP_000560266.1.99562 WP_000560266.1.99571 WP_000560266.1.99592 WP_000560266.1.99602 WP_000560266.1.99603 WP_000560266.1.99666 WP_000560266.1.99694 WP_000560266.1.99698 WP_000560266.1.99771 WP_000560266.1.99782 WP_000560266.1.99804 WP_000560266.1.99869 WP_000560266.1.99891 YP_006121413.1.29421 YP_006777439.1.12065 gi|407471053|ref|YP_006782504.1| 198214.SF3122 198215.S3329 199310.c3840 316385.ECDH10B_3257 316407.ygjM 331111.EcE24377A_3549 373384.SFV_3123 409438.ECSE_3363 413997.ECB_02951 469008.ECBD_0660 481805.EcolC_0618 511145.b3082 573235.ECO26_4184 585055.EC55989_3496 585396.ECO111_3904 585397.ECED1_3750 595496.BWG_2792 gi|386630970|ref|YP_006150690.1| gi|238902192|ref|YP_002927988.1| gi|387613776|ref|YP_006116892.1| gi|387622750|ref|YP_006130378.1| gi|410480850|ref|YP_006768396.1| gi|253772083|ref|YP_003034914.1| gi|386640696|ref|YP_006107494.1| gi|24114377|ref|NP_708887.1| gi|387622750|ref|YP_006130378.1| 5ifg_B 5ifg_D gi|260869833|ref|YP_003236235.1| gi|386706352|ref|YP_006170199.1| gi|218696786|ref|YP_002404453.1| gi|407480290|ref|YP_006777439.1| gi|222157807|ref|YP_002557946.1| 383831 APC28036 ER384 gi|443619148|ref|YP_007383004.1| gi|209920554|ref|YP_002294638.1| gi|471334649|ref|YP_007558126.1| gi|170082624|ref|YP_001731944.1| gi|110806964|ref|YP_690484.1| gi|251786357|ref|YP_003000661.1| gi|388479081|ref|YP_491273.1| gi|157156464|ref|YP_001464544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]