SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5j9i_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5j9i_B
Domain Number 1 Region: 43-90
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000157
Family SinR domain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5j9i_B
Sequence length 104
Comment mol:protein length:104 Antitoxin igA-2
Sequence
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFA
RLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPETLSHIAEL
Download sequence
Identical sequences A0A086SLH6 A0A0F2I781 A0A0H3AER9 A0A0H3Q3Q7 A0A0K9UHF7 A0A0X1KZV1 A0A151JFQ1 C3LV92 D0IIJ5 Q9KMA5
gi|229605921|ref|YP_002876625.1| APC26959 gi|147671949|ref|YP_001215639.1| gi|360037377|ref|YP_004939139.1| gi|379743902|ref|YP_005334954.1| gi|147671949|ref|YP_001215639.1| 243277.VCA0469 345073.VC0395_0803 579112.VCM66_A0431 593588.VCD_000869 gi|227812044|ref|YP_002812054.1| gi|15601230|ref|NP_232861.1| 5j9i_A 5j9i_B 5j9i_C 5j9i_D 5j9i_E 5j9i_F 5j9i_G 5j9i_H NP_232861.1.72393 WP_000071008.1.100264 WP_000071008.1.100388 WP_000071008.1.100440 WP_000071008.1.10071 WP_000071008.1.100924 WP_000071008.1.101051 WP_000071008.1.101149 WP_000071008.1.10121 WP_000071008.1.101220 WP_000071008.1.101314 WP_000071008.1.101507 WP_000071008.1.101677 WP_000071008.1.101933 WP_000071008.1.102054 WP_000071008.1.102100 WP_000071008.1.1024 WP_000071008.1.10313 WP_000071008.1.10626 WP_000071008.1.10834 WP_000071008.1.10887 WP_000071008.1.11270 WP_000071008.1.11879 WP_000071008.1.11965 WP_000071008.1.11987 WP_000071008.1.12252 WP_000071008.1.12262 WP_000071008.1.12332 WP_000071008.1.12486 WP_000071008.1.12525 WP_000071008.1.12527 WP_000071008.1.12548 WP_000071008.1.12590 WP_000071008.1.12686 WP_000071008.1.13053 WP_000071008.1.13155 WP_000071008.1.13156 WP_000071008.1.13454 WP_000071008.1.13652 WP_000071008.1.13725 WP_000071008.1.14080 WP_000071008.1.14179 WP_000071008.1.14257 WP_000071008.1.14263 WP_000071008.1.14353 WP_000071008.1.14904 WP_000071008.1.14995 WP_000071008.1.15109 WP_000071008.1.15134 WP_000071008.1.15179 WP_000071008.1.15200 WP_000071008.1.15516 WP_000071008.1.15786 WP_000071008.1.15997 WP_000071008.1.16057 WP_000071008.1.16115 WP_000071008.1.16351 WP_000071008.1.16382 WP_000071008.1.17232 WP_000071008.1.17295 WP_000071008.1.17621 WP_000071008.1.17738 WP_000071008.1.18375 WP_000071008.1.18392 WP_000071008.1.18447 WP_000071008.1.18577 WP_000071008.1.18862 WP_000071008.1.18916 WP_000071008.1.19126 WP_000071008.1.19128 WP_000071008.1.19428 WP_000071008.1.19442 WP_000071008.1.19503 WP_000071008.1.19597 WP_000071008.1.19924 WP_000071008.1.20065 WP_000071008.1.20107 WP_000071008.1.20336 WP_000071008.1.20379 WP_000071008.1.20404 WP_000071008.1.20602 WP_000071008.1.20669 WP_000071008.1.20699 WP_000071008.1.20758 WP_000071008.1.21073 WP_000071008.1.21281 WP_000071008.1.21558 WP_000071008.1.21671 WP_000071008.1.21717 WP_000071008.1.21764 WP_000071008.1.21815 WP_000071008.1.21866 WP_000071008.1.22521 WP_000071008.1.22770 WP_000071008.1.22773 WP_000071008.1.229 WP_000071008.1.22953 WP_000071008.1.2304 WP_000071008.1.2316 WP_000071008.1.23312 WP_000071008.1.23333 WP_000071008.1.2341 WP_000071008.1.23416 WP_000071008.1.23424 WP_000071008.1.23538 WP_000071008.1.2354 WP_000071008.1.23637 WP_000071008.1.23761 WP_000071008.1.23808 WP_000071008.1.23955 WP_000071008.1.240 WP_000071008.1.2401 WP_000071008.1.2406 WP_000071008.1.24106 WP_000071008.1.24280 WP_000071008.1.24345 WP_000071008.1.24399 WP_000071008.1.2496 WP_000071008.1.24980 WP_000071008.1.25073 WP_000071008.1.25649 WP_000071008.1.26020 WP_000071008.1.26156 WP_000071008.1.26223 WP_000071008.1.2627 WP_000071008.1.26326 WP_000071008.1.26508 WP_000071008.1.26580 WP_000071008.1.27186 WP_000071008.1.27435 WP_000071008.1.27458 WP_000071008.1.27532 WP_000071008.1.27639 WP_000071008.1.27863 WP_000071008.1.28431 WP_000071008.1.2849 WP_000071008.1.28508 WP_000071008.1.29535 WP_000071008.1.29708 WP_000071008.1.29889 WP_000071008.1.30107 WP_000071008.1.30292 WP_000071008.1.3032 WP_000071008.1.30360 WP_000071008.1.3054 WP_000071008.1.30927 WP_000071008.1.31096 WP_000071008.1.31718 WP_000071008.1.32264 WP_000071008.1.32271 WP_000071008.1.32814 WP_000071008.1.32955 WP_000071008.1.33019 WP_000071008.1.33093 WP_000071008.1.33625 WP_000071008.1.33811 WP_000071008.1.33819 WP_000071008.1.34108 WP_000071008.1.34195 WP_000071008.1.34261 WP_000071008.1.34634 WP_000071008.1.34643 WP_000071008.1.34663 WP_000071008.1.3514 WP_000071008.1.35201 WP_000071008.1.35266 WP_000071008.1.35630 WP_000071008.1.35880 WP_000071008.1.35881 WP_000071008.1.36322 WP_000071008.1.3635 WP_000071008.1.36354 WP_000071008.1.36441 WP_000071008.1.36668 WP_000071008.1.36686 WP_000071008.1.36874 WP_000071008.1.36973 WP_000071008.1.37054 WP_000071008.1.37260 WP_000071008.1.37262 WP_000071008.1.37374 WP_000071008.1.37537 WP_000071008.1.37676 WP_000071008.1.37784 WP_000071008.1.37999 WP_000071008.1.38420 WP_000071008.1.38590 WP_000071008.1.39460 WP_000071008.1.39514 WP_000071008.1.39675 WP_000071008.1.39853 WP_000071008.1.39933 WP_000071008.1.40039 WP_000071008.1.40152 WP_000071008.1.40433 WP_000071008.1.40459 WP_000071008.1.40470 WP_000071008.1.40484 WP_000071008.1.40491 WP_000071008.1.40542 WP_000071008.1.40740 WP_000071008.1.40782 WP_000071008.1.41284 WP_000071008.1.41573 WP_000071008.1.4175 WP_000071008.1.42128 WP_000071008.1.42152 WP_000071008.1.42498 WP_000071008.1.42617 WP_000071008.1.4272 WP_000071008.1.4284 WP_000071008.1.42853 WP_000071008.1.42865 WP_000071008.1.42885 WP_000071008.1.43335 WP_000071008.1.4365 WP_000071008.1.43884 WP_000071008.1.439 WP_000071008.1.44555 WP_000071008.1.44569 WP_000071008.1.44709 WP_000071008.1.44730 WP_000071008.1.45055 WP_000071008.1.45127 WP_000071008.1.45155 WP_000071008.1.45206 WP_000071008.1.45264 WP_000071008.1.45372 WP_000071008.1.45704 WP_000071008.1.45842 WP_000071008.1.45903 WP_000071008.1.45958 WP_000071008.1.46118 WP_000071008.1.46146 WP_000071008.1.46486 WP_000071008.1.46540 WP_000071008.1.4661 WP_000071008.1.4701 WP_000071008.1.47202 WP_000071008.1.4731 WP_000071008.1.47417 WP_000071008.1.47428 WP_000071008.1.47736 WP_000071008.1.47794 WP_000071008.1.47796 WP_000071008.1.47846 WP_000071008.1.47942 WP_000071008.1.48128 WP_000071008.1.48289 WP_000071008.1.48305 WP_000071008.1.48715 WP_000071008.1.488 WP_000071008.1.48927 WP_000071008.1.49238 WP_000071008.1.49317 WP_000071008.1.50277 WP_000071008.1.50577 WP_000071008.1.50625 WP_000071008.1.50813 WP_000071008.1.50822 WP_000071008.1.50899 WP_000071008.1.50980 WP_000071008.1.51160 WP_000071008.1.51177 WP_000071008.1.5141 WP_000071008.1.51661 WP_000071008.1.5201 WP_000071008.1.52391 WP_000071008.1.52676 WP_000071008.1.53085 WP_000071008.1.5320 WP_000071008.1.53214 WP_000071008.1.5397 WP_000071008.1.54191 WP_000071008.1.5425 WP_000071008.1.54398 WP_000071008.1.5450 WP_000071008.1.54706 WP_000071008.1.54831 WP_000071008.1.54901 WP_000071008.1.55092 WP_000071008.1.55665 WP_000071008.1.55832 WP_000071008.1.55929 WP_000071008.1.55932 WP_000071008.1.56429 WP_000071008.1.56785 WP_000071008.1.56807 WP_000071008.1.57148 WP_000071008.1.57300 WP_000071008.1.57518 WP_000071008.1.57546 WP_000071008.1.57678 WP_000071008.1.57751 WP_000071008.1.57945 WP_000071008.1.58295 WP_000071008.1.58596 WP_000071008.1.58844 WP_000071008.1.58975 WP_000071008.1.59010 WP_000071008.1.59194 WP_000071008.1.59378 WP_000071008.1.59394 WP_000071008.1.5943 WP_000071008.1.59554 WP_000071008.1.59633 WP_000071008.1.59741 WP_000071008.1.59916 WP_000071008.1.60386 WP_000071008.1.60633 WP_000071008.1.60694 WP_000071008.1.60955 WP_000071008.1.61169 WP_000071008.1.61523 WP_000071008.1.61624 WP_000071008.1.61644 WP_000071008.1.61753 WP_000071008.1.61869 WP_000071008.1.61875 WP_000071008.1.61935 WP_000071008.1.62165 WP_000071008.1.62324 WP_000071008.1.62425 WP_000071008.1.62763 WP_000071008.1.63347 WP_000071008.1.63546 WP_000071008.1.63655 WP_000071008.1.6366 WP_000071008.1.63723 WP_000071008.1.63749 WP_000071008.1.63779 WP_000071008.1.63911 WP_000071008.1.64033 WP_000071008.1.64201 WP_000071008.1.64253 WP_000071008.1.64315 WP_000071008.1.64382 WP_000071008.1.64441 WP_000071008.1.65007 WP_000071008.1.65051 WP_000071008.1.65086 WP_000071008.1.65528 WP_000071008.1.66329 WP_000071008.1.66459 WP_000071008.1.66633 WP_000071008.1.66696 WP_000071008.1.66994 WP_000071008.1.67616 WP_000071008.1.68424 WP_000071008.1.68506 WP_000071008.1.68723 WP_000071008.1.68863 WP_000071008.1.68925 WP_000071008.1.69049 WP_000071008.1.69085 WP_000071008.1.69530 WP_000071008.1.69843 WP_000071008.1.69857 WP_000071008.1.70069 WP_000071008.1.70176 WP_000071008.1.70222 WP_000071008.1.7049 WP_000071008.1.70775 WP_000071008.1.70813 WP_000071008.1.70892 WP_000071008.1.71129 WP_000071008.1.72106 WP_000071008.1.72241 WP_000071008.1.72326 WP_000071008.1.72328 WP_000071008.1.72361 WP_000071008.1.72369 WP_000071008.1.7238 WP_000071008.1.72480 WP_000071008.1.72856 WP_000071008.1.73148 WP_000071008.1.73297 WP_000071008.1.73429 WP_000071008.1.73555 WP_000071008.1.73855 WP_000071008.1.73929 WP_000071008.1.74111 WP_000071008.1.74503 WP_000071008.1.74666 WP_000071008.1.74991 WP_000071008.1.75012 WP_000071008.1.75326 WP_000071008.1.75378 WP_000071008.1.75778 WP_000071008.1.76425 WP_000071008.1.76486 WP_000071008.1.7654 WP_000071008.1.76645 WP_000071008.1.77029 WP_000071008.1.7717 WP_000071008.1.77355 WP_000071008.1.77397 WP_000071008.1.77445 WP_000071008.1.7760 WP_000071008.1.77703 WP_000071008.1.77794 WP_000071008.1.77830 WP_000071008.1.77914 WP_000071008.1.78157 WP_000071008.1.78428 WP_000071008.1.78531 WP_000071008.1.78740 WP_000071008.1.79044 WP_000071008.1.79776 WP_000071008.1.79943 WP_000071008.1.80024 WP_000071008.1.8023 WP_000071008.1.80339 WP_000071008.1.80500 WP_000071008.1.80618 WP_000071008.1.80628 WP_000071008.1.80702 WP_000071008.1.80744 WP_000071008.1.80808 WP_000071008.1.80909 WP_000071008.1.8117 WP_000071008.1.81871 WP_000071008.1.81917 WP_000071008.1.82119 WP_000071008.1.82193 WP_000071008.1.82248 WP_000071008.1.82262 WP_000071008.1.82413 WP_000071008.1.82583 WP_000071008.1.83040 WP_000071008.1.83073 WP_000071008.1.83082 WP_000071008.1.83109 WP_000071008.1.83703 WP_000071008.1.83761 WP_000071008.1.84385 WP_000071008.1.84519 WP_000071008.1.84610 WP_000071008.1.8480 WP_000071008.1.84959 WP_000071008.1.85007 WP_000071008.1.85086 WP_000071008.1.85388 WP_000071008.1.85498 WP_000071008.1.85822 WP_000071008.1.85878 WP_000071008.1.85961 WP_000071008.1.85972 WP_000071008.1.85998 WP_000071008.1.86057 WP_000071008.1.86192 WP_000071008.1.86269 WP_000071008.1.86874 WP_000071008.1.86879 WP_000071008.1.87274 WP_000071008.1.87286 WP_000071008.1.87335 WP_000071008.1.87355 WP_000071008.1.87573 WP_000071008.1.87602 WP_000071008.1.87804 WP_000071008.1.88057 WP_000071008.1.88230 WP_000071008.1.88283 WP_000071008.1.88350 WP_000071008.1.88556 WP_000071008.1.8867 WP_000071008.1.89144 WP_000071008.1.89441 WP_000071008.1.89447 WP_000071008.1.89719 WP_000071008.1.89822 WP_000071008.1.89889 WP_000071008.1.8997 WP_000071008.1.89995 WP_000071008.1.90120 WP_000071008.1.90133 WP_000071008.1.90227 WP_000071008.1.9040 WP_000071008.1.90437 WP_000071008.1.90675 WP_000071008.1.90774 WP_000071008.1.90889 WP_000071008.1.91247 WP_000071008.1.91262 WP_000071008.1.91274 WP_000071008.1.91539 WP_000071008.1.91747 WP_000071008.1.91794 WP_000071008.1.91841 WP_000071008.1.92038 WP_000071008.1.92063 WP_000071008.1.92069 WP_000071008.1.92157 WP_000071008.1.92322 WP_000071008.1.92401 WP_000071008.1.92516 WP_000071008.1.92559 WP_000071008.1.92632 WP_000071008.1.92696 WP_000071008.1.92703 WP_000071008.1.92952 WP_000071008.1.92993 WP_000071008.1.9302 WP_000071008.1.93060 WP_000071008.1.93399 WP_000071008.1.93836 WP_000071008.1.93945 WP_000071008.1.94255 WP_000071008.1.94426 WP_000071008.1.94441 WP_000071008.1.94481 WP_000071008.1.94774 WP_000071008.1.94887 WP_000071008.1.95516 WP_000071008.1.95549 WP_000071008.1.9561 WP_000071008.1.95662 WP_000071008.1.95733 WP_000071008.1.95976 WP_000071008.1.9607 WP_000071008.1.96089 WP_000071008.1.96187 WP_000071008.1.96311 WP_000071008.1.96471 WP_000071008.1.9660 WP_000071008.1.96687 WP_000071008.1.96693 WP_000071008.1.96704 WP_000071008.1.96980 WP_000071008.1.97100 WP_000071008.1.97144 WP_000071008.1.97516 WP_000071008.1.97552 WP_000071008.1.97650 WP_000071008.1.97799 WP_000071008.1.97832 WP_000071008.1.9787 WP_000071008.1.98021 WP_000071008.1.98116 WP_000071008.1.98172 WP_000071008.1.98246 WP_000071008.1.98280 WP_000071008.1.98373 WP_000071008.1.98619 WP_000071008.1.98624 WP_000071008.1.98642 WP_000071008.1.99128 WP_000071008.1.99204 WP_000071008.1.99417 WP_000071008.1.99452 WP_000071008.1.995 WP_000071008.1.99872 WP_000071008.1.99949 WP_000071008.1.99992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]