SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5jtr_G from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5jtr_G
Domain Number 1 Region: 1-35
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000019
Family Phosphate binding protein-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5jtr_G
Sequence length 40
Comment mol:protein length:40 Maltose-binding periplasmic protein
Sequence
KGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV
Download sequence
Identical sequences 5jtr_E 5jtr_F 5jtr_G 5jtr_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]