SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5juf_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5juf_A
Domain Number 1 Region: 2-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000243
Family SinR domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5juf_A
Sequence length 310
Comment mol:protein length:310 Transcriptional regulator
Sequence
MNLKDSIGLRIKTERERQQMSREVLCLDGAELTVRQLIRIEKGESLPSLDRLSYIAKRLG
KSMTELLDQDNITIPDEYYEMKNRLIKFPTYRNPDRIKSKLTLIEEVYEKFFDILPEEEL
LTLDILENILSFTSWEESPKVEEIYEDLFEQVKRKRKFSTNDLLVIDYYFFHLYGRKQYD
KKLFERIIKRVLNQEIWTDDVYNIVLFNDLMAIAALKIFHNSFSDFLTVVDKALAVIEKS
QLYSYKPSVFVLKAKYELLHKENKKEAAENYDKAIVFASVLEDSVLEESIKAGKLADGLG
AGWSHPQFEK
Download sequence
Identical sequences A0A1L1QK15
5jub_A 5jub_B 5juf_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]