SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5uk3_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5uk3_B
Domain Number 1 Region: 94-153
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.24e-31
Family SCOPe 0.068
Further Details:      
 
Domain Number 2 Region: 16-89
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000971
Family SinR domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5uk3_B
Sequence length 176
Comment mol:protein length:176 Uncharacterized protein
Sequence
MRIYSRLFQISSANYARQIMSNQFIKAKESKGLTYQQMAQLLSVNKVWLTSVLHGQNCCD
IQLAHRICDTLGISHEYANELTSIPLRGNQNIINDPLIYRFNELFKVYGSSLRGIIHEEF
GDGIMSAIDCKIDVTKNEQSRVILRIDGKFLPYYKGQLDAGENLYFQSAGHHHHHH
Download sequence
Identical sequences 5uk3_A 5uk3_B 5uk3_C 5uk3_D 5uk3_E 5uk3_F 5uk3_G 5uk3_H 5uk3_I 5uk3_J

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]