SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5y6a_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5y6a_B
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000035
Family NE1354 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5y6a_B
Sequence length 151
Comment mol:protein length:151 chain A and B
Sequence
GSMTIKLLDEFLKKHDLTRYQLSKLTGISQNTLKDQNEKPLNKYTVSILRSLSLISGLSV
SDVLFELEDIEKNSDDLAGFKHLLDKYKLSFPAQEFELYCLIKEFESANIEVLPFTFNRF
ENEEHVNIKKDVCKALENAITVLKEKKNELL
Download sequence
Identical sequences 5y6a_A 5y6a_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]