SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 6b9r_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6b9r_C
Domain Number 1 Region: 326-429
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00000282
Family Germin/Seed storage 7S protein 0.089
Further Details:      
 
Domain Number 2 Region: 240-300
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000128
Family SinR domain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6b9r_C
Sequence length 450
Comment mol:protein length:450 Hydroxyethylphosphonate dioxygenase
Sequence
MSTPDALGSDAARAARAAALLRAAANDLKRNDRAAEADLGLPPGSFGDYVSGRLPITWDL
ISRAAQAWPLNERDLLPIHNDTPQGLRMMRVKESEASSRIIERGGGPYYEYRDTAMSRQA
SYRPEWISMLRVVEDDDPDNPLVEWNKGHLLYQFTYFVGPVNYYFRSGGRSHCVPMNTGD
SVWGLPFAPHSFTARSADEPAYILALTYGGELTGDAQRELATFGRAVTSSLALTPGDHGA
MLRSVMAARLTTVTELADRSGLKTDRVAALCRTPARAEWPELSALAEALGVSVRELLVPH
TTTEADVRIQPGRTASRWSYPGPDAPAYRFTQLAGDPLHPHTTSLAVDVLTARPDAPLPP
TYQHQYLYVLGEQPVSVRWRYNGEQYDGRLEPGDSAYVIPGIEFSLSAEKPTELLMLRIG
GSATPDVRFALGAMPDGAIGRYIAEDRLWY
Download sequence
Identical sequences WP_032782080.1.41460 6b9r_A 6b9r_B 6b9r_C 6b9r_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]