SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 6b9t_F from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6b9t_F
Domain Number 1 Region: 252-304
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000138
Family EDF1-like 0.078
Further Details:      
 
Domain Number 2 Region: 144-205,278-413
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00000696
Family TM1459-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6b9t_F
Sequence length 457
Comment mol:protein length:457 Methylphosphonate synthase
Sequence
MEKKIDFKPDSYLIRSGNNFLGILNDIKRRPEDAANELGVSIEEINSIISGKQKISPSLI
EKAVNIWPVNERDFYIVSDDCSSGILIMTSQDSIKSSRIMERAGKPYYEYRDTAMSKTAP
FRPEWILELCKVENNDPENPKAQWNNGHFMHQFTYFIGEVNFYYKDPEGKKHVAIMNTGD
SMYITPFTPHTFTTRDGASQNGLILALTYGSKLTGDIQQELSSLSLDCGSQYALDFTNHE
NASLSLLEYYFELSNLTKEKFAKRTNFSMETLADFFTKKKLPTFDELKIIAKALNVNSRD
LMPNDLTESKVIVKTHDQCDHWKYPESGNYEFYELASTTALPHSKAFEIDVSSSEDLNLD
LKVGLHQYVYNIGDSALTINWNYENKTYQKSLNPGDSAYIKPFVPHNFRGNGKILILRIG
GKISGDSQRELSFVGRENTQRAISETMQWFDPKGSNS
Download sequence
Identical sequences A9A1T2
gi|161527665|ref|YP_001581491.1| 6b9s_A 6b9s_B 6b9s_C 6b9s_D 6b9s_E 6b9s_F 6b9s_G 6b9s_H 6b9t_A 6b9t_B 6b9t_C 6b9t_D 6b9t_E 6b9t_F 6b9t_G 6b9t_H 436308.Nmar_0155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]