SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 6cro_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6cro_A
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.27e-27
Family Phage repressors 0.0000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6cro_A
Sequence length 60
Comment mol:protein length:60 LAMBDA CRO REPRESSOR
Sequence
eqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsn
Download sequence
Identical sequences 000046231|e6croA1|101.1.4.1|A:1-60 cath|current|6croA00/2-61 d6croa_ 6cro_A 6croA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]