SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 6f8s_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6f8s_C
Domain Number 1 Region: 10-91
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.7e-24
Family SinR domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6f8s_C
Sequence length 99
Comment mol:protein length:99 XRE family transcriptional regulator
Sequence
MLKNGMRPIHPGEILREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLS
ICLDTTPEFWLNLQTAFDLRTAEQQHGDEIIGSVQRLVA
Download sequence
Identical sequences A0A179R2V1 Q88MI6
gi|26988317|ref|NP_743742.1| NP_743742.1.35174 WP_010952669.1.28295 WP_010952669.1.28475 WP_010952669.1.3142 WP_010952669.1.41 WP_010952669.1.58218 WP_010952669.1.675 WP_010952669.1.71439 WP_010952669.1.87606 160488.PP_1585 6f8s_A 6f8s_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]