SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ccu_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ccu_A
Domain Number 1 Region: 4-258
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.41e-141
Family Carbonic anhydrase 0.0000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1ccu_A
Sequence length 259
Comment mol:protein length:259 CARBONIC ANHYDRASE II
Sequence
shhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
nghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlv
hwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
gllpesldywtypgslhtppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
dnwrpaqplknrqikasfk
Download sequence
Identical sequences 1ccuA cath|current|1ccuA00/5-260 1ccu_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]