SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1cf3_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1cf3_A
Domain Number 1 Region: 14-319,516-579
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.29e-74
Family FAD-linked reductases, N-terminal domain 0.0000000000065
Further Details:      
 
Domain Number 2 Region: 325-520
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.07e-42
Family GMC oxidoreductases 0.00000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1cf3_A
Sequence length 583
Comment mol:protein length:583 PROTEIN (GLUCOSE OXIDASE)
Sequence
SNGIEASLLTDPKDVSGRTVDYIIAGGGLTGLTTAARLTENPNISVLVIESGSYESDRGP
IIEDLNAYGDIFGSSVDHAYETVELATNNQTALIRSGNGLGGSTLVNGGTWTRPHKAQVD
SWETVFGNEGWNWDNVAAYSLQAERARAPNAKQIAAGHYFNASCHGVNGTVHAGPRDTGD
DYSPIVKALMSAVEDRGVPTKKDFGCGDPHGVSMFPNTLHEDQVRSDAAREWLLPNYQRP
NLQVLTGQYVGKVLLSQNGTTPRAVGVEFGTHKGNTHNVYAKHEVLLAAGSAVSPTILEY
SGIGMKSILEPLGIDTVVDLPVGLNLQDQTTATVRSRITSAGAGQGQAAWFATFNETFGD
YSEKAHELLNTKLEQWAEEAVARGGFHNTTALLIQYENYRDWIVNHNVAYSELFLDTAGV
ASFDVWDLLPFTRGYVHILDKDPYLHHFAYDPQYFLNELDLLGQAAATQLARNISNSGAM
QTYFAGETIPGDNLAYDADLSAWTEYIPYHFRPNYHGVGTCSMMPKEMGGVVDNAARVYG
VQGLRVIDGSIPPTQMSSHVMTVFYAMALKISDAILEDYASMQ
Download sequence
Identical sequences B2CNX9
1cf3A 1cf3_A 1gal_A 3qvp_A 3qvr_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]