SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1e1m_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1e1m_A
Domain Number 1 Region: 109-331
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.84e-56
Family C-terminal domain of adrenodoxin reductase-like 0.00000000202
Further Details:      
 
Domain Number 2 Region: 5-168
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 9.88e-19
Family N-terminal domain of adrenodoxin reductase-like 0.00000252
Further Details:      
 
Domain Number 3 Region: 309-459
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000191
Family N-terminal domain of adrenodoxin reductase-like 0.000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1e1m_A
Sequence length 460
Comment mol:protein length:460 ADRENODOXIN REDUCTASE
Sequence
stqeqtpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevkn
vintftqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedhqaldipgeelpgv
fsarafvgwynglpenrelapdlscdtavilgqgnvaldvarilltppdhlektditeaa
lgalrqsrvktvwivgrrgplqvaftikelremiqlpgtrpmldpadflglqdrikeaar
prkrlmelllrtatekpgveeaarrasasrawglrffrspqqvlpspdgrraagirlavt
rlegigeatravptgdvedlpcglvlssigyksrpidpsvpfdpklgvvpnmegrvvdvp
glycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsafikalldsrgvw
pvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh
Download sequence
Identical sequences 1cjc_A 1e1k_A 1e1l_A 1e1m_A 1e1n_A 1e6e_A 1e6e_C 1cjcA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]