SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ewt_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ewt_B
Domain Number 1 Region: 8-481
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.02e-208
Family L-arabinose binding protein-like 0.000000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1ewt_B
Sequence length 490
Comment mol:protein length:490 METABOTROPIC GLUTAMATE RECEPTOR SUBTYPE 1
Sequence
ssqrsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinad
pvllpnitlgseirdscwhssvaleqsiefirdslisirdekdglnrclpdgqtlppgrt
kkpiagvigpgsssvaiqvqnllqlfdipqiaysatsidlsdktlykyflrvvpsdtlqa
ramldivkrynwtyvsavhtegnygesgmdafkelaaqeglciahsdkiysnageksfdr
llrklrerlpkarvvvcfcegmtvrgllsamrrlgvvgefsligsdgwadrdeviegyev
eanggitiklqspevrsfddyflklrldtntrnpwfpefwqhrfqcrlpghllenpnfkk
vctgnesleenyvqdskmgfvinaiyamahglqnmhhalcpghvglcdamkpidgrklld
flikssfvgvsgeevwfdekgdapgrydimnlqyteanrydyvhvgtwhegvlniddyki
qmnksgmvrs
Download sequence
Identical sequences 1ewkA 1ewk_A 1ewk_B 1ewt_A 1ewt_B 1ewv_A 1ewv_B 1isr_A 1iss_A 1iss_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]