SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1f8w_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1f8w_A
Domain Number 1 Region: 1-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.96e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000146
Further Details:      
 
Domain Number 2 Region: 322-445
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.71e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1f8w_A
Sequence length 447
Comment mol:protein length:447 NADH PEROXIDASE
Sequence
mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflscgmqlylegkvkdvnsvry
mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldi
pgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvidi
ldrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvvv
avgvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialat
namkqgrfavknleepvkpfpgvqgssglavfdykfastginevmaqklgketkavtvve
dylmdfnpdkqkawfklvydpettqilgaqlmskadltaninaislaiqakmtiedlaya
dfffqpafdkpwniintaaleavkqer
Download sequence
Identical sequences 1f8w_A 1f8wA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]